KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_01510Help
Entry
SAA6008_01510     CDS       T01886                                 

Definition
(GenBank) conserved hypothetical protein
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flp_Fap DUF2073 DUF2547
Motif
Other DBs
NCBI-ProteinID: ADL65549
Position
complement(1626039..1626296)
Genome map
AA seq 85 aa AA seqDB search
MAGFLLIGLITLLLIPMMNQMQASINHKLQTIDASKVILTTVSKINKEELKKGVTIGKYD
MKQSDQQICAISKNTTSYQKTCIQY
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
atggctggatttttgctaattggattgattacattactattgataccaatgatgaatcaa
atgcaagcgagtataaaccataaactacaaacaattgatgcttctaaagtaattttgacg
actgtatctaaaattaataaagaagaacttaagaagggggtaactatagggaagtatgat
atgaagcaaagtgaccaacaaatttgtgctatttcaaaaaataccacttcttatcaaaag
acatgtatacagtattaa

DBGET integrated database retrieval system