KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_01524Help
Entry
SAA6008_01524     CDS       T01886                                 

Gene name
mreB
Definition
(GenBank) ABC superfamily ATP binding cassette transporter, membrane protein
  KO
K09816  zinc transport system permease protein
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Pathway
suk02010  ABC transporters
Module
suk_M00242  Zinc transport system
Brite
KEGG Orthology (KO) [BR:suk00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SAA6008_01524 (mreB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:suk02000]
    SAA6008_01524 (mreB)
Transporters [BR:suk02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Zinc transporter [MD:M00242] [OT]
    SAA6008_01524 (mreB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC-3 FecCD
Motif
Other DBs
NCBI-ProteinID: ADL65563
Position
complement(1637211..1638074)
Genome map
AA seq 287 aa AA seqDB search
MIDALLNFDFMRYSLISGILIGFIAPLIGAFIVVRRLSLIADALSHVTLGGISFGMFLLT
IMPTLVFINPMWFGILFAIVGALLIEKLRTSYTAYQEIAIPIIMSAGIALSAIFISLADG
FNQEIVGLLFGSISAVNISDLTTIIVIAIIVVLFITLFYKELFILSFDEEYSKVIGIPKW
IQFLFIVIVAMVISASMRVVGILLVSALITLPIAISMRITKSFKQLILLSVFLGELSVIL
GLVLAFYMDISPGGVIVVLLVILLMITMAYQKMRMKFKKGANINEYK
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
ttgatagatgcattattgaattttgattttatgaggtactctttaattagtggtatcttg
ataggttttattgcgcctctaatcggtgcttttatcgttgttagacgactatcacttata
gctgatgctctaagtcatgtaactttaggtggtatatctttcggtatgtttttacttact
attatgccaacactagtatttattaatccaatgtggtttggaatcttattcgcaatagta
ggtgcgcttctaattgaaaaattaagaacgtcatacactgcttaccaagaaattgctatt
ccaattataatgagtgctggtatcgccttgagtgcaatcttcatttcattagctgatggg
ttcaatcaagaaattgttggattgctatttggctcaataagcgcagtgaatataagtgat
ttaacaacgattattgtcattgccatcatagttgttctgtttattacattgttttataaa
gaattatttatattgtcatttgatgaggaatatagtaaagtcattggcattcctaaatgg
attcaatttttatttattgttattgtagcgatggttatttctgcctcaatgcgtgttgta
gggatactgttagtaagtgcgttaatcacgttaccaattgcaataagtatgcgaataaca
aaaagttttaagcaattgatattactaagtgtatttttaggtgaattatcagtaatatta
ggcttagtcctagctttctatatggacatttctccgggtggtgtaattgtagttctactt
gttattttacttatgattacaatggcttatcagaaaatgcgaatgaagtttaaaaaggga
gctaatatcaatgaatacaaatga

DBGET integrated database retrieval system