KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_01548Help
Entry
SAA6008_01548     CDS       T01886                                 

Gene name
prmA
Definition
(GenBank) ribosomal protein L11 methyltransferase
  KO
K02687  ribosomal protein L11 methyltransferase [EC:2.1.1.-]
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Brite
KEGG Orthology (KO) [BR:suk00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:suk03009]
    SAA6008_01548 (prmA)
Enzymes [BR:suk01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     SAA6008_01548 (prmA)
Ribosome biogenesis [BR:suk03009]
 Prokaryotic Type
  ribosomal protein modification factors
   SAA6008_01548 (prmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PrmA MTS Methyltransf_31 Methyltransf_18 Methyltransf_25 Methyltransf_11 Methyltransf_12 Methyltransf_23 Met_10 Spermine_synth PCMT Cons_hypoth95 GidB UPF0020 TRM
Motif
Other DBs
NCBI-ProteinID: ADL65585
Position
complement(1659194..1660132)
Genome map
AA seq 312 aa AA seqDB search
MNWTELSIIINHEAVELATNILENHGSNGVVIEDSDDLINQPEDKYGEIYALKKEDYPDK
GVRLKAYFNEMTYDDKLRQQIKDELLNLDELDQHNVQFSEQIIAETDWENEWKNYFHPFR
ASKKFTIVPSWETYAKEADEELCIELDPGMAFGTGDHPTTSMCLKAIETYVLPQHSVIDV
GTGSGILSIASHLIGVKRIKALDIDEMAVSVAKENFRRNHCETLIEAVPGNLLKDETEKF
DIVIANILAHIIDEMIEDAYNTLNEGGYFITSGIIKEKYEGIQSHMERVGFKIISEQHDN
GWVCLVGQKVSE
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaactggacagagctttcaattattattaatcatgaagcagtagaattggctaccaat
atacttgaaaatcatggatcaaatggtgtcgtgatagaagattcagatgatttaattaac
caaccagaagataaatacggtgaaatttacgctttgaaaaaagaggattatccagataag
ggagtaagattgaaagcctattttaatgaaatgacttatgatgataagttgcgacagcaa
attaaagatgagttattaaatttagatgaacttgatcaacataacgttcaattcagtgag
caaattattgcagagacggattgggaaaatgaatggaaaaactatttccatccattccga
gcgtcgaagaagttcacaatagttcctagttgggaaacatatgctaaagaagcggatgaa
gagctttgcattgagctcgacccaggtatggcttttggaacaggtgatcatccgactaca
agtatgtgtttgaaggcaatagaaacatatgtattgccacagcattcagtaattgatgtt
ggtactggctcaggtatattaagtattgcaagtcatctaatcggtgtaaaacgtattaaa
gcgttggatattgatgaaatggcagtgagtgtagctaaagaaaacttcagaagaaatcat
tgtgaaacgttaattgaagctgttccaggtaacttattgaaagacgaaacagaaaaattt
gatattgtaatagcaaatattttagcgcatattattgatgaaatgattgaagatgcttat
aatactctaaatgaaggcggttattttattacttctggtattataaaagagaagtatgaa
ggtatacagtcacatatggagcgtgtaggttttaaaattatttcagaacaacatgacaac
ggttgggtttgtcttgttggccagaaagtgagtgaataa

DBGET integrated database retrieval system