KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_01549Help
Entry
SAA6008_01549     CDS       T01886                                 

Gene name
dnaJ
Definition
(GenBank) chaperone protein DnaJ
  KO
K03686  molecular chaperone DnaJ
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Brite
KEGG Orthology (KO) [BR:suk00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:suk03110]
    SAA6008_01549 (dnaJ)
   03029 Mitochondrial biogenesis [BR:suk03029]
    SAA6008_01549 (dnaJ)
Chaperones and folding catalysts [BR:suk03110]
 Heat shock proteins
  HSP40 / DNAJ
   SAA6008_01549 (dnaJ)
Mitochondrial biogenesis [BR:suk03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    SAA6008_01549 (dnaJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DnaJ_C DnaJ DnaJ_CXXCXGXG zf-C2H2_10 Anti-TRAP Cytochrome_C7 DUF5351 Cytochrom_c3_2 Cytochrome_C554
Motif
Other DBs
NCBI-ProteinID: ADL65586
Position
complement(1660136..1661275)
Genome map
AA seq 379 aa AA seqDB search
MAKRDYYEVLGINKDASKDEIKKAYRKLSKKYHPDINKEEGADEKFKEISEAYEVLSDDN
KRASYDQFGHDGPQGFGGQGFNGSDFGGFSGFGGGGFEDIFSSFFGGGRQRDPNAPQKGD
DLQYTMTLTFEEAVFGTTKEISIRKDVTCETCHGDGAKPGTSKKTCSYCNGAGHVAVEQN
TILGRVRTEQVCPKCNGSGQEFEEACPTCHGKGTENKTVKLEVKVPEGVDNEQQIRLAGE
GSPGVNGGPAGDLYVVFRVKPSETFKRDGDDIYYKLNVSFPQAALGDEIKIPTLNNEVML
TIPAGTQTGKQFRLKEKGIKNVHGYGYGDLYVDIKVVTPTKLTDRQKELMKEFAQLNGEE
INEQPSNFKDRAKRFFKGE
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
gtggccaaaagagattattatgaagttttaggcattaataaggatgcttcaaaagatgaa
atcaaaaaagcgtatcgaaagctttcgaaaaaatatcatccagatattaacaaagaagaa
ggtgcagatgaaaagtttaaagaaatttctgaagcctatgaagttttaagtgatgataat
aaacgcgcaagctatgatcaatttggacatgatggtccacaaggttttggtggacaagga
ttcaatggctctgactttggcggttttagtggcttcggtggcggcggttttgaagatatc
tttagctctttcttcggtggcggcagacaaagagatccaaatgcaccgcaaaaaggtgat
gatcttcagtatacaatgacattaacatttgaagaagcggtatttggtacaacaaaagaa
atttcaatccgtaaagatgtaacatgcgaaacatgtcatggtgatggtgcaaagcctgga
acaagtaaaaagacttgtagttactgtaatggcgctggtcatgtagctgtagaacaaaac
acaattttaggtagagttcgtactgaacaagtttgtcctaaatgtaatggaagtggtcaa
gaatttgaagaagcttgtccaacatgtcacggaaaaggtactgaaaataaaacagttaaa
ttagaagtgaaagtacctgaaggtgtcgacaatgaacaacaaattagattagctggtgaa
ggctctccaggcgtgaatggaggacctgctggtgatttatacgtagtatttagagttaaa
ccatctgaaacatttaaacgtgatggtgatgatatttattacaaattaaatgttagcttc
ccacaagcagctttaggcgatgaaataaaaataccaacattaaataatgaagttatgtta
acaatccctgctggtacacaaacaggtaagcaattccgcttaaaagaaaagggtataaaa
aatgttcatggctatggatacggagatttatatgttgatattaaagtagtaacgcctact
aaattaacagatagacaaaaagaactaatgaaagaatttgcccaattaaatggtgaagaa
attaatgaacaaccttcgaattttaaagatagagcaaaaagattctttaagggagaataa

DBGET integrated database retrieval system