KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_01568Help
Entry
SAA6008_01568     CDS       T01886                                 

Definition
(GenBank) haloacid dehalogenase-like hydrolase
  KO
K07015  uncharacterized protein
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Brite
KEGG Orthology (KO) [BR:suk00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    SAA6008_01568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase_like Hydrolase_3 PGP_phosphatase Hydrolase Hydrolase_6 Cellulase
Motif
Other DBs
NCBI-ProteinID: ADL65604
Position
complement(1678150..1678677)
Genome map
AA seq 175 aa AA seqDB search
MGLVRKFFMPNSYVQSIFQIDLDKLVDKGVKGIITDLDNTLVGWDVKEPTERVKAWFKEA
NEKGITITIVSNNNESRVASFSQHLDIDFIFKARKPMGKAFDKAITKMNIRPDQTVVIGD
QMLTDVFGGNRRGLYTIMVVPVKRTDGFITKFNRLIERRLLRHFSKKGYITWEEN
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgggtttagttcgcaagttttttatgccgaattcatatgttcaatcaatatttcaaatt
gatttagacaagttagtggacaaaggcgttaaaggtattattacagatttagataatacg
ctagtaggttgggatgttaaagaacctacagaacgtgttaaagcatggtttaaggaagct
aatgaaaaaggaatcactattacaatcgtgtctaataataatgagtctcgtgttgctagt
tttagtcagcatttagacatcgattttatttttaaagcgagaaagccaatggggaaagcg
tttgataaagcaataactaagatgaatatcagaccagatcaaactgttgttataggtgac
caaatgcttactgatgtatttggtggtaatcgtcgaggtctatatacaattatggttgtt
ccagttaaacgaactgatggctttattactaagtttaatagattaattgaaagacgatta
ttacgtcatttcagtaaaaaaggttatatcacatgggaggaaaattga

DBGET integrated database retrieval system