KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_01577Help
Entry
SAA6008_01577     CDS       T01886                                 

Gene name
accB_1
Definition
(GenBank) acetyl-CoA carboxylase biotin carboxyl carrier protein subunit, Acc_B1
  KO
K02160  acetyl-CoA carboxylase biotin carboxyl carrier protein
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Pathway
suk00061  Fatty acid biosynthesis
suk00620  Pyruvate metabolism
suk00640  Propanoate metabolism
suk01100  Metabolic pathways
suk01110  Biosynthesis of secondary metabolites
suk01120  Microbial metabolism in diverse environments
suk01130  Biosynthesis of antibiotics
suk01200  Carbon metabolism
suk01212  Fatty acid metabolism
Module
suk_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:suk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAA6008_01577 (accB_1)
   00640 Propanoate metabolism
    SAA6008_01577 (accB_1)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SAA6008_01577 (accB_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biotin_lipoyl RnfC_N GCV_H Biotin_lipoyl_2 ATP-synt_ab_Xtn BET Peptidase_M23
Motif
Other DBs
NCBI-ProteinID: ADL65613
Position
complement(1686212..1686661)
Genome map
AA seq 149 aa AA seqDB search
MNIEKIEQIIKLVKENDVKKFKYKNFEDEIEIDFTDSNHLAAHSNQSNQSMNNNDLTASK
ANDNSDVSTNDYHDIKSPMIGTFFLQDSKELTEPIVNVGDKVNKGDIIGYVEAMKVLNEV
TTDVAGEITEIVADHGTNVEYDQVLVRIK
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgaatattgaaaaaatcgaacaaataatcaaattagtgaaggaaaatgatgttaagaaa
tttaaatataaaaattttgaagatgaaatagaaattgacttcactgactcgaatcatttg
gctgcacacagtaatcaatcaaatcaaagtatgaacaataatgatttgacagcttcaaaa
gcgaatgataactccgatgtttcgacaaatgattatcatgacattaaatcaccaatgata
ggtacattctttttacaagatagtaaagaattaactgaaccaattgtgaatgtcggtgac
aaagttaacaagggagatattataggatatgttgaagcgatgaaagtattaaacgaggta
acaacagatgttgctggagaaattactgaaatagtagctgatcatggcacaaatgttgaa
tacgaccaagttttggtacgtattaagtaa

DBGET integrated database retrieval system