KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_01589Help
Entry
SAA6008_01589     CDS       T01886                                 

Gene name
recD
Definition
(GenBank) exodeoxyribonuclease V alpha chain
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Pathway
suk03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:suk00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    SAA6008_01589 (recD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:suk03400]
    SAA6008_01589 (recD)
Enzymes [BR:suk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SAA6008_01589 (recD)
DNA repair and recombination proteins [BR:suk03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     SAA6008_01589 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 UvrD_C_2 AAA_11 Viral_helicase1 HHH_5 T2SSE AAA AAA_12 AAA_18 AAA_14 AAA_29 Mg_chelatase TsaE NTPase_1 Helicase_RecD ABC_tran HHH_3 UvrD_C 5_3_exonuc AAA_28 RsgA_GTPase Zeta_toxin AAA_22 AAA_16 DUF815 NACHT ATPase
Motif
Other DBs
NCBI-ProteinID: ADL65625
Position
complement(1697030..1699474)
Genome map
AA seq 814 aa AA seqDB search
MIKGTVEAILFQNSDNFYTVLKVDTIETNEDFDTMPTVVGFLPNIVEGDVYTFKGQVVDH
PRYGKQLKAETFEKEMPQTKEAIISYLSSDLFKGVGKKTAQNIVNTLGDNAINDILDDHS
VLEKVSGLSKKKQKQIAEQISANQESEKIMIRLHDLGFGPKLSMAIYQFYLGDTLTILDR
NPYQLIYDIKGIGFNKADQLARNIGIAYNDNERLKAALLYTLEECIKQGHTYLPINVVID
LTVDVLNYQDEEVIEPEKLDEMLQYLNEEKRLIIDNEQVAIPSLYYSEIKSVQNLFRIKT
HTNKLTEIEQSDLQMHIGEIEDANQVNYAASQKEALQTAINSKVMLLTGGPGTGKTTVIK
GIVELYAEIHGLSLDYDDYVNDDYPVVLAAPTGRASKRLQESTGLEAMTIHRLIGWNQDT
KPEDILENEINARLIIIDEMSMVDTWLFHQFLSAVPLDAQLIFVGDEDQLPSVGPGQVFK
DLIESKAIPRVNLTEVYRQQDGSSIIELAHRMKLGQKIDITQRFHDRSFINCQANQIPTV
VEKVVTSAVNKGYTMADIQVLAPMYKGNAGIKRLNQVLQDILNPKKKDTREIEFGDVVFR
KGDKVLQLVNRPNDNIFNGDIGVIVGIFWAKENALNKDVLVVDFEGNEITFTKQDMMELT
HAYCTSIHKSQGSEFPIVIMPIVKQYFRMLQRPILYTGLTRAKTSLVLLGDPEAFDIGLK
TNGQARLTQLCTLLKNYFNSEDEEMLENTATNDTGASQTTIDDQVEAPMSSNDSEEVMSD
STKTDTNVLTEATMFKIDPMINMGEITPYDFIER
NT seq 2445 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaggtactgttgaagcgatattgtttcaaaacagtgataatttttatacagtg
cttaaagtagatactattgaaacaaatgaagactttgatacaatgccaactgttgtaggg
tttcttccgaatattgttgaaggcgatgtctacacatttaaagggcaagttgttgatcat
ccacgttatggtaaacaattaaaagcagagacttttgaaaaagaaatgccacaaacgaaa
gaagcaattataagttatttatctagtgatttgtttaaaggtgtaggtaaaaagacagct
caaaatattgttaatacattaggtgacaatgcgataaatgatatattagatgaccattca
gtgctagaaaaagtttcgggattatctaaaaagaaacagaaacaaattgcagaacaaatt
tcagcaaatcaagaatctgaaaaaataatgattcgtttacatgatttagggtttggtcct
aaactttcaatggcaatttatcagttttatctcggcgatacactgactattttagatcga
aatccatatcaattgatttatgatattaaaggtattggttttaataaagcagatcaactt
gctagaaatattggtatcgcttataacgataatgaacgattaaaagctgcgttgctctat
acgttagaagaatgtattaaacagggacatacatatttgcctatcaatgttgttatagat
ttaacggttgatgtattaaattatcaagatgaagaggtcatcgaacctgaaaaattagac
gaaatgttgcaatacttaaatgaggaaaaacgactaattattgacaatgaacaagttgca
attccaagtttgtattattctgaaatcaaaagtgttcaaaacttattcagaataaagacg
catacaaataaacttacagaaattgaacagtcagatttacaaatgcatattggtgaaata
gaagatgcgaatcaagtgaactatgcagcttcacaaaaagaagctttgcaaacggctatc
aattctaaggtgatgctattaaccggtggaccgggaacaggaaaaacgacagtaattaaa
ggtattgttgaattatatgctgagattcatggcttatcattagattatgatgattatgtc
aatgatgattatccagttgtattagcagcgccaacaggaagagcgtctaagagactacaa
gagtcaactggattagaagcaatgacgattcatcgtttaataggttggaatcaagacaca
aagccagaggatatattagaaaatgaaataaacgcacgactcataatcattgatgagatg
tctatggtagatacttggttgttccaccaatttttaagtgcagttcctttagatgcacaa
ttgatatttgtaggtgatgaggaccaattgccttctgtaggtcctggtcaagtatttaaa
gatttaattgaatcgaaagctataccacgagtaaatctgactgaagtatatcgtcaacaa
gatggttcaagcattatagaattagcacatcgaatgaagttgggtcagaaaattgatatt
acacagcgttttcatgatagaagttttattaactgtcaggcaaaccaaataccaacagtt
gttgagaaggtagttactagtgctgttaataaagggtatactatggctgatattcaagtg
cttgcaccaatgtataaaggaaatgccggtattaaacgtttaaatcaagttttacaagat
attttaaaccctaaaaagaaagacacacgagaaattgagtttggtgatgtagtctttaga
aaaggtgacaaagtattacaacttgttaataggccaaatgataacatattcaatggtgac
ataggagttattgttggtattttttgggcgaaagaaaatgcccttaataaagatgtactt
gttgtggattttgaaggtaatgaaattacatttacgaaacaagatatgatggaattaaca
catgcttattgtacatcaatccataaatcacaaggttcagaatttcctattgttatcatg
cctattgttaaacagtattttagaatgttacaaagaccgatattatatactggtttaact
agagcgaaaacgagtttagttttacttggtgatccggaagcatttgatattggattgaaa
acaaatggtcaagcgcgtttaacacaattatgtacattgttgaaaaattattttaattca
gaagatgaagaaatgctggaaaacacagcaactaatgatacaggagcttcacaaacgaca
atagatgatcaagtagaagcgccaatgtcatcgaatgatagtgaagaagttatgtctgat
tcaacaaaaacagatacaaatgtattaacggaagctacaatgtttaaaattgacccaatg
attaatatgggagaaatcacgccgtatgactttatagaacgttga

DBGET integrated database retrieval system