KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_01597Help
Entry
SAA6008_01597     CDS       T01886                                 

Gene name
rarA
Definition
(GenBank) DNA-directed DNA polymerase III gamma and tau subunits
  KO
K07478  putative ATPase
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Brite
KEGG Orthology (KO) [BR:suk00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    SAA6008_01597 (rarA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MgsA_C AAA_assoc_2 AAA RuvB_N Sigma54_activat AAA_14 AAA_5 AAA_16 Mg_chelatase DNA_pol3_delta2 TIP49 Sigma54_activ_2 Rad17 ABC_tran AAA_19 AAA_18 IstB_IS21 AAA_3 Parvo_NS1 AAA_24 LXG NB-ARC RNA_helicase AAA_2 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ADL65633
Position
1705434..1706708
Genome map
AA seq 424 aa AA seqDB search
MSTEPLASRMRPKNIDEIISQQHLVGPRGIIRRMVDTKKLTSMIFYGPPGIGKTSIAKAI
SGSTQYKFRQLNAVTNTKKDMQLVVEEAKMSGQVILLLDEIHRLDKAKQDFLLPHLENGK
IVLIGATTSNPYHAINPAIRSRAQIFELYPLNDEDVRQALTRAIEDDENGLKTYQPKIDE
DAMTYFSTQSQGDVRSALNALELAVLSADNDKDGYRHVTLQDAKDCLQKGAFVSDKDGDM
HYDVMSAFQKSIRGSDVNAALHYLARLIEAGDLPTIVRRLLVISYEDIGLASPNAGQRTL
AAIESAERLGLPEARIPLSQAVIELCLSPKSNSAMSAIDSALSDIRNGHVGQIPNHLKDG
HYQGAKDLGRSIGYKYPHQYVNGYVSQQYLPDKLKNKIYYEPKTTSKSEQQLKEIYNNLL
KQRP
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
gtgagtacagaaccattagcatcgagaatgcgcccaaaaaatatagatgaaatcatttcc
caacaacatttagttggaccaagaggcattatcagaagaatggttgatacaaaaaaatta
acttcaatgattttttatggtccacctggtataggcaaaacaagtattgccaaagcaatt
tcgggcagtacgcaatataaattcagacaattgaatgctgtaactaacactaaaaaagat
atgcaacttgttgttgaagaagctaaaatgtctggtcaagttatcttgttattagatgaa
atacatcgactagataaagctaaacaagactttttattacctcatttagaaaatggcaaa
atcgtcttgatcggtgctacaacttcaaatccttatcatgctatcaatccagcgattcgt
tcaagagcgcaaattttcgagttatatcctttaaatgacgaagatgtgcgccaagcgtta
actcgtgcaatagaagatgatgagaatggtttgaaaacatatcaacccaaaattgatgaa
gatgccatgacctacttttctacacaaagccaaggtgatgttcgtagtgcgttaaatgca
ttggaattagctgtattaagcgcagataatgacaaagacggttatcgacatgttacattg
caagatgctaaagactgtttacaaaaaggtgcatttgtaagtgacaaggatggtgacatg
cattacgatgttatgagcgctttccaaaaatctatccgtggtagcgacgtcaatgccgct
ttacattatttagcacgattaattgaagctggagatttacctacaatagttcgacgatta
cttgtaattagctatgaggatataggcttagcctcacctaatgctggtcagagaacactt
gctgctattgaatcagcagaacgtctaggtttaccagaagctagaattccactaagccaa
gcagtaatcgaactatgcttatcacctaagtcaaattcagcaatgagtgccattgatagt
gcattgtccgatattagaaacggtcatgtgggccaaattccaaaccatttaaaagatgga
cattatcaaggtgctaaagatctaggccgatctattggttacaaatatccacaccaatat
gttaatggctatgtttcacagcaatatttacctgataaactaaaaaacaaaatttattac
gaaccaaaaacgacatctaaaagtgaacaacaactcaaagaaatatataacaacttactt
aaacaaaggccgtaa

DBGET integrated database retrieval system