KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_01602Help
Entry
SAA6008_01602     CDS       T01886                                 

Gene name
dtd
Definition
(GenBank) D-tyrosyl-tRNA (Tyr) deacylase
  KO
K07560  D-aminoacyl-tRNA deacylase [EC:3.1.1.96]
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Brite
KEGG Orthology (KO) [BR:suk00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:suk03016]
    SAA6008_01602 (dtd)
Enzymes [BR:suk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.96  D-aminoacyl-tRNA deacylase
     SAA6008_01602 (dtd)
Transfer RNA biogenesis [BR:suk03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Trans-editing factors
    SAA6008_01602 (dtd)
 Prokaryotic Type
    SAA6008_01602 (dtd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tyr_Deacylase
Motif
Other DBs
NCBI-ProteinID: ADL65638
Position
complement(1712480..1712932)
Genome map
AA seq 150 aa AA seqDB search
MKVVVQRVKEASVTNDTLNNQIKKGYCLLVGIGQNSTEQDADVIAKKIANARLFEDDNNK
LNFNIQQMNGEILSVSQFTLYADVKKGNRPGFSNSKNPDQAVKIYEYFNDALRAYGLTVK
TGEFGTHMNVSINNDGPVTIIYESQDGKIQ
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtagttgtacaaagagttaaagaagcatcggtgacgaatgatacattaaataat
caaatcaaaaaaggatattgtttattagtcggtatcggtcagaactctacagagcaagat
gcagatgtaattgcaaagaaaattgctaatgcaagattatttgaagatgacaataataaa
ttaaactttaatatccaacaaatgaatggtgaaatactatcagtttcacaatttactctc
tatgcagatgtaaaaaaaggtaaccgtccaggtttctcaaattctaaaaatcctgatcaa
gcggtaaaaatttatgagtattttaatgatgcgctacgagcgtatggtcttactgtgaaa
acaggtgaatttggaacacacatgaatgttagcataaataatgatggtccagtcactatt
atttatgaaagtcaggacggcaaaattcaatga

DBGET integrated database retrieval system