KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_01641Help
Entry
SAA6008_01641     CDS       T01886                                 

Gene name
engB
Definition
(GenBank) ribosome biogenesis GTP-binding protein YsxC
  KO
K03978  GTP-binding protein
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Brite
KEGG Orthology (KO) [BR:suk00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:suk03036]
    SAA6008_01641 (engB)
Chromosome and associated proteins [BR:suk03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    SAA6008_01641 (engB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MMR_HSR1 FeoB_N Dynamin_N RsgA_GTPase AIG1 GTP_EFTU IIGP Septin cobW AAA_29 RNA_helicase ABC_tran
Motif
Other DBs
NCBI-ProteinID: ADL65677
Position
complement(1752612..1753202)
Genome map
AA seq 196 aa AA seqDB search
MKVNPNNIELIISAVKEEQYPETELSEVALSGRSNVGKSTFINSMIGRKNMARTSQQPGK
TQTLNFYNIDEQLIFVDVPGYGYAKVSKTQREKFGKMIEEYITKRENLQLVIQLVDLRHD
PTQDDILMYNYLKHFDIPTLVICTKEDKIPKGKVQKHIKNIKTQLDMDPDDTIVSYSSIQ
NNKQQQIWNLIEPYIS
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttaatcctaataatatagaattaatcattagtgcagtaaaagaagaacaatat
ccagaaacagaattgtctgaagttgcactgagcggtcgatctaatgtaggtaagtctaca
tttatcaatagtatgattggcagaaaaaatatggcacgtacatcacagcaacccggcaaa
acgcaaacgttaaatttttataatatagatgaacaacttatttttgtggatgttccaggg
tatggatatgctaaagtaagtaaaacacaacgtgaaaaatttgggaaaatgattgaggaa
tatataactaagagagagaatttgcaattagttattcaattagttgatttaagacatgat
ccaacacaagatgatatcttaatgtacaattatttgaaacattttgatattcctacttta
gttatatgcactaaagaagacaaaattccaaaaggtaaggttcaaaagcatattaaaaat
attaagacacaattagatatggacccagacgatacaattgtaagttattcatcaattcaa
aataataaacaacaacaaatatggaatttaattgaaccgtatatttcatag

DBGET integrated database retrieval system