KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_01642Help
Entry
SAA6008_01642     CDS       T01886                                 

Gene name
clpX
Definition
(GenBank) ATP-dependent Clp protease, ATP-binding subunit ClpX
  KO
K03544  ATP-dependent Clp protease ATP-binding subunit ClpX
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Brite
KEGG Orthology (KO) [BR:suk00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:suk03110]
    SAA6008_01642 (clpX)
Chaperones and folding catalysts [BR:suk03110]
 Heat shock proteins
  HSP100
   SAA6008_01642 (clpX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_2 zf-C4_ClpX ClpB_D2-small AAA AAA_5 AAA_22 RuvB_N Mg_chelatase MCM Sigma54_activat IstB_IS21 AAA_18 TsaE Sigma54_activ_2 AAA_14 AAA_16 ABC_tran NACHT AAA_24 T2SSE Cytidylate_kin AAA_28 PhoH RNA_helicase AAA_33 PduV-EutP ResIII C1_2
Motif
Other DBs
NCBI-ProteinID: ADL65678
Position
complement(1753356..1754618)
Genome map
AA seq 420 aa AA seqDB search
MFKFNEDEENLKCSFCGKDQDQVKKLVAGSGVYICNECIELCSEIVEEELAQNTSEAMTE
LPTPKEIMDHLNEYVIGQEKAKKSLAVAVYNHYKRIQQLGPKEDDVELQKSNIALIGPTG
SGKTLLAQTLAKTLNVPFAIADATSLTEAGYVGDDVENILLRLIQAADFDIDKAEKGIIY
VDEIDKIARKSENTSITRDVSGEGVQQALLKILEGTTASVPPQGGRKHPNQEMIQIDTTN
ILFILGGAFDGIEEVIKRRLGEKVIGFSSNEADKYDEQALLAQIRPEDLQAYGLIPEFIG
RVPIVANLETLDVTALKNILTQPKNALVKQYTKMLELDDVDLEFTEEALSAISEKAIERK
TGARGLRSIIEESLIDIMFDVPSNENVTKVVITAQTINEETEPELYDAEGNLINNSKTSA
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaattcaatgaagatgaagaaaatttgaaatgctctttctgcggaaaagaccaa
gatcaagtaaaaaaacttgtagcaggaagtggtgtatatatttgtaatgagtgtattgaa
ttatgctcagaaatcgtcgaagaagaattagctcaaaacacttctgaagcgatgacagaa
ttacctactcctaaagaaattatggatcatttaaacgaatatgttattggtcaagaaaaa
gctaaaaaatctttagctgtagctgtttataaccactataagcgtattcaacaattagga
ccaaaagaagatgatgttgaattacaaaaaagtaacattgcattaattgggccaacaggt
agtggtaaaacattattagctcaaaccttagccaagacgttgaatgtaccatttgcaatt
gcagatgcgacaagtttaactgaagctggttatgtaggcgatgatgttgaaaatatcttg
ttgagattaattcaagcagctgactttgacattgataaagccgaaaaaggtattatttat
gtagatgaaattgataaaattgcacgtaaatctgaaaacacatctataacacgtgacgtt
tcaggtgaaggtgttcaacaagcattgcttaaaatcttagaaggtacgactgcaagtgtt
ccgccacaaggtggacgcaaacatccaaaccaagaaatgattcaaattgatacaacaaat
atcttatttattcttggtggtgcctttgatggtattgaagaagtgattaagcgccgtctt
ggtgaaaaagttattggtttctcaagcaatgaagctgataaatatgacgaacaagcatta
ttagcacaaattcgcccagaagatttgcaagcctatggtttgattcctgaatttatcgga
cgtgtgccaattgtagctaatttagaaacattagatgtaactgcgttgaaaaacatctta
acgcaacctaaaaatgcacttgtgaaacaatatactaaaatgctggaattagatgatgtg
gatttagagttcactgaagaagctttatcagcaattagtgaaaaagcaattgaaagaaaa
acaggtgcgcgtggtttacgttcaatcatagaagaatcgttaatcgatattatgtttgat
gtgccttctaacgaaaatgtaacgaaggtagttattacagcacaaacaattaatgaagaa
actgaaccagaactatacgacgcagaaggcaatttaattaataatagtaaaacatcagct
taa

DBGET integrated database retrieval system