KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_01654Help
Entry
SAA6008_01654     CDS       T01886                                 

Gene name
gapB
Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Pathway
suk00010  Glycolysis / Gluconeogenesis
suk01100  Metabolic pathways
suk01110  Biosynthesis of secondary metabolites
suk01120  Microbial metabolism in diverse environments
suk01130  Biosynthesis of antibiotics
suk01200  Carbon metabolism
suk01230  Biosynthesis of amino acids
Module
suk_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
suk_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:suk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAA6008_01654 (gapB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:suk04131]
    SAA6008_01654 (gapB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:suk04147]
    SAA6008_01654 (gapB)
Enzymes [BR:suk01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     SAA6008_01654 (gapB)
Membrane trafficking [BR:suk04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SAA6008_01654 (gapB)
Exosome [BR:suk04147]
 Exosomal proteins
  Proteins found in most exosomes
   SAA6008_01654 (gapB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C Gp_dh_N DapB_N 2-Hacid_dh_C Ribosomal_L14e
Motif
Other DBs
NCBI-ProteinID: ADL65690
Position
complement(1766598..1767623)
Genome map
AA seq 341 aa AA seqDB search
MSTNIAINGMGRIGRMVLRIALQNKNLNVVAINASYPPETIAHLINYDTTHGKYNLKVEP
IENGLQVGNHKIKLVADRNPENLPWKELDIDIAIDATGKFNHGDKAIAHIKAGAKKVLLT
GPSKGGHVQMVVKGVNDNQLDIEAFDIFSNASCTTNCIGPVAKVLNNQFGIVNGLMTTVH
AITNDQKNIDNPHKDLRRARSCNESIIPTSTGAAKALKEVLPELEGKLHGMALRVPTKNV
SLVDLVVDLEKEVTAEEVNQAFENAGLEGIIEVEHQPLVSVDFNTNPNSAIIDAKSTMVM
SGNKVKVIAWYDNEWGYSNRVVDVAEQIGALLTSKETVSAS
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacgaatattgcaattaatggtatgggtagaattggaagaatggtattacgtatt
gcattacaaaataaaaatttaaatgtagtagcgataaatgctagttatccacccgaaaca
attgcacatttaatcaattacgatacgacacatggaaaatataatctaaaagttgaaccg
attgaaaatggattgcaagttggaaatcataaaattaaattggttgctgatcgcaatcct
gaaaacttgccatggaaagaattagatatcgatattgctatagatgcaactggtaaattt
aatcatggtgataaagccatcgcacatattaaagcaggtgccaaaaaagttttgttaact
ggtccttcaaaaggtggacatgttcaaatggtagttaaaggcgtaaatgataaccaatta
gatatagaagcatttgacatttttagtaatgcttcatgtactactaattgcattggtcca
gttgcaaaagttttaaataatcagtttggaatagttaatggtttaatgactactgttcac
gctattacaaatgaccaaaaaaatattgataatccacataaagatttaagacgtgcacgt
tcatgtaatgaaagcattattcctacttctactggtgcggcgaaagctttaaaagaagta
ttaccagaattagaaggtaaattacacggcatggcattacgtgtaccaacaaagaatgta
tcgctcgttgatttagttgttgatttagaaaaagaagtaactgcagaagaagtaaaccaa
gcttttgaaaatgcaggtttagaaggtatcatagaagtcgaacatcaaccactagtgtct
gttgattttaatactaatccaaattcagctattattgatgcaaaatcaacaatggtcatg
tcagggaataaagtaaaagttattgcttggtatgataatgaatggggttattcaaataga
gttgtagatgttgctgagcaaattggagcacttttgacatcaaaagaaactgtaagtgca
agttaa

DBGET integrated database retrieval system