KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_01657Help
Entry
SAA6008_01657     CDS       T01886                                 

Gene name
polA
Definition
(GenBank) DNA-directed DNA polymerase I
  KO
K02335  DNA polymerase I [EC:2.7.7.7]
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Pathway
suk00230  Purine metabolism
suk00240  Pyrimidine metabolism
suk01100  Metabolic pathways
suk03030  DNA replication
suk03410  Base excision repair
suk03420  Nucleotide excision repair
suk03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:suk00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SAA6008_01657 (polA)
   00240 Pyrimidine metabolism
    SAA6008_01657 (polA)
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SAA6008_01657 (polA)
   03410 Base excision repair
    SAA6008_01657 (polA)
   03420 Nucleotide excision repair
    SAA6008_01657 (polA)
   03440 Homologous recombination
    SAA6008_01657 (polA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:suk03032]
    SAA6008_01657 (polA)
   03400 DNA repair and recombination proteins [BR:suk03400]
    SAA6008_01657 (polA)
Enzymes [BR:suk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     SAA6008_01657 (polA)
DNA replication proteins [BR:suk03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     SAA6008_01657 (polA)
DNA repair and recombination proteins [BR:suk03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA polymerase I
     SAA6008_01657 (polA)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     SAA6008_01657 (polA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol_A 5_3_exonuc_N 5_3_exonuc DNA_pol_A_exo1 HHH_5
Motif
Other DBs
NCBI-ProteinID: ADL65693
Position
complement(1769320..1771950)
Genome map
AA seq 876 aa AA seqDB search
MNKLVLIDGNSLSFRAFYALPLLSNKAGIHTNAVYGFAMLLEKILKEEKPNHFLVAFDAG
KTTFRHEKYSEYKGGRQKTPPELSEQFPYIRQLLDAYHIKRYELDNYEADDIIGTLSKEA
DKAGFQTIIITGDRDLTQLATDNVTIYYTKKGVTDVDHYTPDFIAEKYNGLTPNQIIDMK
GLMGDTSDNIPGVAGVGEKTAIKLLNQFDTVEGVYEHLDEISGKKLKEKLQNSKEDALMS
KELATINVDSPIEVKLEDTLMTHQDEQQEKIELFKKLEFKQLLADIDQSASVEDAIEKTF
EIETSFDNIDFTSLKEAAIHFELDGGNYLRNNILKFSLFTGEKHIVINADDINNYVELVS
WLENPNSKKVVYDAKKTYVASHRLGIDIQNISFDIMLASYIIDPSRTISDVQSVVSLYGQ
SFVKDDVSIYGKGKKFKVPEDDVLNPYVASITDAIYFAKPNMDKQLEEYNQVELLADLEL
PLAKILSEMEEIGIFTDVHDLEEMEKEIQEKLDVLIRNIHDAAGEDFNINSPKQLGVVLF
ETLQLPVIKKTKTGYSTAVDVLEQLQGEHPIIDYILEYRQLSKLQSTYVEGLQKVISDDQ
RIHTRFNQTLAQTGRLSSVDPNLQNIPVRLEEGRKIRKAFKPTSKDSVILSADYSQIELR
VLAHITQDESMKEAFINGDDIHTATAMKVFGVEADQVDSLMRRQAKAVNFGIVYGISDYG
LSQSLGITRKKAKAFIDDYLASFPGVKQYMSDIVKDAKALGYVETLLHRRRYIPDITSRN
FNLRGFAERTAMNTPIQGSAADIIKLAMVKFAQKMKETTYQAKLLLQVHDELIFEVPKSE
VDSFSEFVEEIMENALQLDVPLKVDSSYGATWYDAK
NT seq 2631 nt NT seq  +upstreamnt  +downstreamnt
gtgaataaattagtattaatcgatggtaatagcttaagttttagagctttttatgcatta
cctttgttatcaaacaaagcaggcattcataccaatgcagtatatggttttgcaatgtta
ctagagaagattttaaaagaagaaaagccaaatcattttttagtagcgtttgatgcaggt
aaaacgactttcagacatgaaaaatatagtgaatataaaggtggacgccagaaaacgccg
cctgaactaagtgagcaatttccttatattcgccaattattagatgcttatcatattaaa
cgttatgaattagataactatgaggcagatgatattatcggaactttaagtaaagaagca
gataaagcgggctttcagacaattattattacgggagaccgagatttaacacaacttgca
acggataatgtaaccatttattacactaaaaaaggtgttactgatgttgatcattataca
cctgactttattgcggaaaaatacaacgggttaacacctaatcaaattattgatatgaaa
ggattaatgggagatacttctgataatataccaggtgttgcaggtgttggagagaaaaca
gcaataaaattgctaaaccaatttgacacagtagaaggtgtctatgaacatttagatgaa
atttcaggtaaaaagttaaaagaaaaacttcaaaatagcaaagaagatgcattaatgagt
aaagaattagcaacgattaatgtagatagtccgattgaagtaaaacttgaagatacgtta
atgactcatcaagatgaacaacaagaaaaaatcgaattgtttaagaagttagaattcaaa
caattgttggctgacattgatcaatcagcaagcgttgaagatgcaatagaaaagacattt
gaaattgaaacgtcttttgataatattgattttacttcattgaaagaagcggccatccat
ttcgaattagacggtggtaactatttgcgaaataatattttaaaattctctttatttaca
ggtgagaaacatattgtaattaatgcggatgacataaataattatgtcgaactagtttca
tggttagaaaatccgaattcgaaaaaagtcgtatatgatgctaaaaaaacatatgtagca
tcacatagattggggattgatattcaaaatatttctttcgatattatgttggccagttat
ataattgatccatctcgtacgattagtgatgttcaatcagttgtttcattgtacggtcaa
agttttgtgaaagacgatgtgagtatatatggaaaaggtaagaaatttaaggtacctgaa
gatgatgttttaaatccatatgttgcttctattactgatgcaatttactttgcgaaacca
aatatggataaacaattagaagaatacaatcaggtagaactcttggctgatttagagcta
ccgctagctaagattttaagtgaaatggaagaaattggtatatttacagatgttcatgat
ttagaagaaatggaaaaagaaattcaagaaaaattagacgtcttgattcgaaatatccat
gatgcagctggtgaagattttaatataaattctcctaagcaattaggtgttgtattgttt
gagacattacaattacctgttattaaaaagacgaaaacaggatattctactgctgtagat
gtcttagagcaattgcaaggtgaacatcctatcattgattatattttagaatatcgtcaa
ttatctaagttacagtctacttatgttgaaggattgcaaaaggtaattagtgatgatcaa
cgtatccatacacgttttaatcaaactttagcgcaaactggacgtttatcaagtgtagat
cctaatttacaaaatattccggttagacttgaagaagggcgtaaaataagaaaagccttt
aaaccaacttcaaaagatagcgttatattatcagcagattattctcaaattgaattgcgt
gtattagcacacattacacaagatgagagtatgaaagaagcatttatcaacggcgatgat
attcatacagcaactgctatgaaagtatttggtgtagaagctgatcaagtcgatagttta
atgcgtcgtcaagcaaaagcagttaactttggaattgtttatgggataagtgattatggt
ttaagtcaaagtttaggtattactcgtaaaaaagcaaaagcattcattgatgattattta
gctagtttcccaggtgtaaaacaatatatgtctgatattgtaaaagatgccaaagcttta
ggttacgtggaaacattgctacatcgtcgacgctatattcctgatattacgagtcgtaac
tttaatttacgcggctttgctgaacgtactgctatgaatacgccaatacagggcagtgct
gcagatatcattaaactggcaatggttaaatttgctcaaaaaatgaaagagacaacatat
caagctaaactattattacaagtacacgatgaattaatttttgaagtacctaagtcagaa
gtagattcatttagtgaatttgtagaagagataatggaaaatgcattgcaattagatgtt
ccattaaaagtagactcaagttatggtgcaacctggtatgatgcaaaataa

DBGET integrated database retrieval system