KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_01661Help
Entry
SAA6008_01661     CDS       T01886                                 

Gene name
citC
Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Pathway
suk00020  Citrate cycle (TCA cycle)
suk00480  Glutathione metabolism
suk01100  Metabolic pathways
suk01110  Biosynthesis of secondary metabolites
suk01120  Microbial metabolism in diverse environments
suk01130  Biosynthesis of antibiotics
suk01200  Carbon metabolism
suk01210  2-Oxocarboxylic acid metabolism
suk01230  Biosynthesis of amino acids
Module
suk_M00009  Citrate cycle (TCA cycle, Krebs cycle)
suk_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:suk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAA6008_01661 (citC)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SAA6008_01661 (citC)
Enzymes [BR:suk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     SAA6008_01661 (citC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ADL65697
Position
complement(1776985..1778253)
Genome map
AA seq 422 aa AA seqDB search
MTAEKITQGTEGLNVPNEPIIPFIIGDGIGPDIWKAASRVIDAAVEKAYNGEKRIEWKEV
LAGQKAFDTTGEWLPQETLDTIKEYLIAVKGPLTTPIGGGIRSLNVALRQELDLFTCLRP
VRWFKGVPSPVKRPQDVDMVIFRENTEDIYAGIEFKEGTTEVKKVIDFLQNEMGATNIRF
PETSGIGIKPVSKEGTERLVRAAIQYAIDNNRKSVTLVHKGNIMKFTEGSFKQWGYDLAL
SEFGDQVFTWQQYDEIVENEGRDAANAAQEKAEKEGKIIIKDSIADIFLQQILTRPAEHD
VVATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYAGLNKVNPSS
VILSSVLMLEHLGWQEAADKITDSIEDTIASKVVTYDFARLMDGAEEVSTSAFADELIKN
LK
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgactgcagaaaaaattactcaaggaactgaaggattaaacgtacctaatgaaccaatt
atcccatttattatcggtgatggaattggaccggatatttggaaggcagcaagccgagtt
atagatgctgctgttgagaaagcctataatggcgaaaaacgcattgaatggaaagaagtg
ctagctggccaaaaagcatttgatacaactggtgaatggttacctcaagaaacacttgat
acaattaaagaatatttaattgctgttaaaggacctttaacaacaccaattggtggtggt
attagatcattaaatgtggctttacgccaagaattagatttatttacttgcttaagaccg
gtacgttggtttaaaggagtaccatcacctgttaaacgtccacaagatgttgatatggtt
attttccgtgaaaatactgaagacatttatgctggtattgaatttaaagaaggtacaaca
gaagttaaaaaggtaattgacttcttacaaaacgaaatgggtgcgacaaacattcgattc
ccagaaacttcaggtattggtattaaaccagtttctaaagaaggaactgagcgattagtt
agagcagctatacaatatgctatcgataataaccgtaaatcagttactttagttcataaa
ggtaatattatgaaatttacagaaggctcatttaagcagtggggttacgatttagcatta
tctgaatttggtgatcaagtattcacttggcaacaatatgacgaaattgttgaaaatgaa
ggcagagatgctgctaatgctgctcaagaaaaagctgaaaaagaaggcaagattatcatt
aaagattctattgctgacattttcttacaacaaattttaactcgtccagctgagcatgat
gttgtagcaactatgaacttgaatggtgactatatttcagatgctttagctgcacaagtt
ggtggtattggtattgcgccaggtgcaaacattaattatgaaacaggtcatgctattttt
gaagcaacacatggtacagctccaaaatatgcaggtttaaataaagtgaatccatcttca
gtaattttaagttctgtattaatgttagaacatttaggatggcaagaagcggcagataag
attacagattcaattgaagatacaattgcttcaaaagttgttacttatgactttgcccgt
ttaatggatggtgctgaagaagtttctacatcagcatttgcagatgaattgattaaaaat
ttaaaataa

DBGET integrated database retrieval system