KEGG   Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA): SAA6008_02201Help
Entry
SAA6008_02201     CDS       T01886                                 

Gene name
arg
Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
suk  Staphylococcus aureus subsp. aureus JKD6008 (MRSA/VISA)
Pathway
suk00220  Arginine biosynthesis
suk00330  Arginine and proline metabolism
suk01100  Metabolic pathways
suk01110  Biosynthesis of secondary metabolites
suk01130  Biosynthesis of antibiotics
suk01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:suk00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    SAA6008_02201 (arg)
   00330 Arginine and proline metabolism
    SAA6008_02201 (arg)
Enzymes [BR:suk01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     SAA6008_02201 (arg)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ADL66217
Position
complement(2319610..2320518)
Genome map
AA seq 302 aa AA seqDB search
MTKTKAIDIIGAPSTFGQRKLGVDLGPTAIRYAGLISRLKQLDLDVYDKGDIKVPAVNIE
KFHSEQKGLRNYDEIIDVNQKLNKEVSASIENNRFPLVLGGDHSIAVGSVSAISKHYNNL
GVIWYDAHGDLNIPEESPSGNIHGMPLRILTGEGPKELLELNSNVIKPENIVLIGMRDLD
KGERQFIKDHNIKTFTMSDIDKLGIKEVIENTIEYLKSRNVDGVHLSLDVDALDPLETPG
TGTRVLGGLSYRESHFALELLHQSHLISSMDLVEVNPLIDSNNHTAEQAVSLVGTFFGET
LL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagacaaaagcaattgatattataggtgcaccatcaacatttggacaaagaaaa
ttaggtgttgatttaggaccaacagcaattagatatgctggattaatttcaagattaaag
caattagaccttgatgtatatgacaagggggatattaaggtacctgctgtgaacattgaa
aaatttcatagtgaacaaaaaggattaagaaattatgatgaaattatagatgttaatcaa
aaattaaataaagaggtttcagcatcaattgaaaataacagatttcctctagttcttggt
ggagatcattctattgcggtaggttcagtatcagcaataagtaaacattataataattta
ggtgttatttggtatgatgcacatggtgatttaaatatacctgaagagtcaccaagtgga
aatattcatggtatgcctctaaggattttgacaggcgaaggtcccaaagaacttttagaa
ttaaatagtaatgtaatcaagccagaaaacatcgtactaattggtatgagagatttagat
aaaggtgaaagacaatttatcaaagatcataatattaaaacatttactatgtcagatatt
gataaattggggataaaggaagtaattgaaaatacaatagaatatttgaagtcacgcaat
gttgatggcgttcatttatctttagatgttgatgctttagatccgcttgaaacgccaggc
actggtactagagttttgggtggtcttagttatagagaaagccattttgcattggaatta
ctgcatcaatcacatttaatttcctcaatggatttagttgaagtaaatccattgattgac
agtaataatcatactgctgaacaagcggtttcattagttggaacattttttggtgaaact
ttattataa

DBGET integrated database retrieval system