KEGG   Sulfurihydrogenibium sp. YO3AOP1: SYO3AOP1_0014Help
Entry
SYO3AOP1_0014     CDS       T00715                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
sul  Sulfurihydrogenibium sp. YO3AOP1
Pathway
sul00010  Glycolysis / Gluconeogenesis
sul00052  Galactose metabolism
sul00500  Starch and sucrose metabolism
sul00520  Amino sugar and nucleotide sugar metabolism
sul00521  Streptomycin biosynthesis
sul01100  Metabolic pathways
sul01110  Biosynthesis of secondary metabolites
sul01120  Microbial metabolism in diverse environments
sul01130  Biosynthesis of antibiotics
sul01200  Carbon metabolism
Module
sul_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sul00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SYO3AOP1_0014
   00052 Galactose metabolism
    SYO3AOP1_0014
   00500 Starch and sucrose metabolism
    SYO3AOP1_0014
   00520 Amino sugar and nucleotide sugar metabolism
    SYO3AOP1_0014
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SYO3AOP1_0014
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SYO3AOP1_0014
Enzymes [BR:sul01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SYO3AOP1_0014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase Hexokinase_2 Hydant_A_N BcrAD_BadFG RBD-FIP
Motif
Other DBs
NCBI-ProteinID: ACD65665
UniProt: B2V640
Position
15961..16839
Genome map
AA seq 292 aa AA seqDB search
MILGIDIGGTFIKVVGKDENNNIFKEKISVNFQDKKTFVSEILKLIEKHKALKVGIAIAG
LVDKKSGQLTNSPNLKFLEGLNLKQEIENHSNIKVFIENDANLAAYGEYVYGNGKDSEIL
VCLTLGTGLGGGAVIGGKIISGVSGSAMEIGHIAVEKNGLPCHCGRNGCLEAYVSSYGLE
RIYCMLTEKKTTSFEIVNLAKNKDEKALKSFEMFSNYLSTGIMNIAHIFNPDKILLAGGI
IEHYPDILEIVREKTKNLIFPLPLRDLKIDMAKLGSWSGAFGALAFAEGHSS
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
ttgattcttggaattgatattggtgggacttttataaaggttgttggtaaagatgagaat
aataacatttttaaagagaaaattagcgttaattttcaggataaaaaaacttttgtaagt
gaaatacttaaattaatagaaaaacacaaagctttaaaagttggtatagccattgccgga
cttgttgataaaaaatccggtcagcttacaaactcaccaaatctaaagtttttagaaggt
ttgaatttaaagcaggagatagaaaatcacagtaatatcaaagtgtttatagagaatgat
gcaaatcttgctgcttatggtgagtatgtttacggaaatggcaaagatagcgaaattctt
gtctgcttgacccttggaaccggtcttggtggtggtgctgtaattggtggtaaaatcatc
tccggcgtctcgggtagtgctatggagataggtcatattgctgttgaaaaaaatggacta
ccatgccactgtggaagaaatggttgtttagaagcttatgtgtcttcctacggacttgaa
aggatatactgtatgcttacagaaaaaaagacaacatcttttgagatagttaatcttgct
aagaacaaagatgaaaaagctttaaaatcttttgagatgtttagtaattacttatcaacc
ggtattatgaatattgctcatatatttaatcctgacaaaatactgctggcgggcggcatt
atagaacattatcctgatattttagagattgttagagaaaaaacaaaaaatcttattttt
ccattaccacttagagatttaaaaattgatatggcaaagcttggaagttggagtggtgct
tttggtgcattagcttttgcggaaggtcattcttcgtag

DBGET integrated database retrieval system