KEGG   Sulfurihydrogenibium sp. YO3AOP1: SYO3AOP1_0479Help
Entry
SYO3AOP1_0479     CDS       T00715                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
sul  Sulfurihydrogenibium sp. YO3AOP1
Pathway
sul00900  Terpenoid backbone biosynthesis
sul01100  Metabolic pathways
sul01110  Biosynthesis of secondary metabolites
sul01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sul00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SYO3AOP1_0479
Enzymes [BR:sul01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     SYO3AOP1_0479
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXPR_C DXP_reductoisom Semialdhyde_dh DapB_N
Motif
Other DBs
NCBI-ProteinID: ACD66120
UniProt: B2V847
Position
complement(491705..492832)
Genome map
AA seq 375 aa AA seqDB search
MLKVGILGSTGSVGSQALDVIRKYKDQIKVELLGASKLSENLINQIKEFKPSYVYVENAE
EKSIDDIKVLVGEDGLRRAVNLDLDLFINAIAGIKGILPTYLLLKYNKTLATANKEAIIC
LGELLKDKYKKILPIDSEHSAIFQILKDSNQKEVRRIILTASGGPFVNMPAEDFENITVK
QALIHPRWSMGKKITIDSATLMNKGLEVIEAHYLFSMPYEKIDVLIHPESIIHGMVEFVD
GTVISNMSNPDMKIPISYALFYPERKFLSDNYLDFTKIKSLNFLKPDTEKFPLLKLAVEC
GKKGGVYPTVLTVADEIAVNYFLEERIKFTDIHKIILETLEKFDYNKLDSVDDIFYIIDK
TINLATEIAKKYGST
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
ttgttaaaagttggaatacttggttctaccggttctgttggaagtcaggcattagatgtt
atcagaaagtataaagaccaaataaaggttgaacttcttggagcttctaagttatctgaa
aatcttataaatcagattaaagagtttaaaccatcttatgtttatgttgaaaatgcagaa
gaaaaaagtatagatgatataaaggttttggttggagaagatggattaaggcgggctgtt
aatcttgatttggatttatttataaatgcgattgcaggaataaaaggcattcttcctact
tatctactgcttaaatacaataaaactcttgcaaccgcaaacaaagaagctattatttgt
cttggagagctacttaaagataagtataaaaaaattcttccaatagatagtgagcattct
gctatttttcagatacttaaagatagtaatcaaaaagaagttagaagaattattctaaca
gcttccggcggtccctttgtaaatatgccggctgaagattttgaaaatatcacagttaaa
caagcattaatccatccaagatggagtatgggtaagaaaataaccatagatagtgcaacg
ctgatgaataaagggttagaagttatagaagcccattatctgttttcaatgccctatgaa
aaaatagatgtgctgatccatccagaaagtatcatacacggaatggttgaatttgttgat
ggaactgttatatctaacatgtctaaccctgatatgaaaattcctatatcatatgcttta
ttttatccggaaagaaagtttttatctgataattacttagattttacaaagattaagtcg
cttaactttttaaaaccagacacagaaaaatttccgttgttaaaacttgccgttgagtgt
ggtaaaaaaggcggtgtatatccaacagttttgaccgtagcagatgagatagccgttaac
tactttttagaagaaaggataaagtttacagatatacacaaaattatcttagagacctta
gaaaagtttgattacaacaaacttgattccgtagatgatatattttatataattgataaa
acaataaatttagcaacagagatagcaaagaagtatggaagtacttga

DBGET integrated database retrieval system