KEGG   Sulfurihydrogenibium sp. YO3AOP1: SYO3AOP1_0612Help
Entry
SYO3AOP1_0612     CDS       T00715                                 

Definition
(GenBank) thiamine pyrophosphate protein domain protein TPP-binding
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
sul  Sulfurihydrogenibium sp. YO3AOP1
Pathway
sul00010  Glycolysis / Gluconeogenesis
sul00020  Citrate cycle (TCA cycle)
sul00620  Pyruvate metabolism
sul00640  Propanoate metabolism
sul00650  Butanoate metabolism
sul00680  Methane metabolism
sul00720  Carbon fixation pathways in prokaryotes
sul01100  Metabolic pathways
sul01120  Microbial metabolism in diverse environments
sul01130  Biosynthesis of antibiotics
sul01200  Carbon metabolism
Module
sul_M00173  Reductive citrate cycle (Arnon-Buchanan cycle)
sul_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sul00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SYO3AOP1_0612
   00020 Citrate cycle (TCA cycle)
    SYO3AOP1_0612
   00620 Pyruvate metabolism
    SYO3AOP1_0612
   00640 Propanoate metabolism
    SYO3AOP1_0612
   00650 Butanoate metabolism
    SYO3AOP1_0612
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    SYO3AOP1_0612
   00680 Methane metabolism
    SYO3AOP1_0612
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    SYO3AOP1_0612
Enzymes [BR:sul01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     SYO3AOP1_0612
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: ACD66249
UniProt: B2V8H6
Position
complement(627465..628499)
Genome map
AA seq 344 aa AA seqDB search
MAKKVTIQVLADLAQEREEKYHSHNPLAPGHRMCIGCGIPPIVNEVLLAIDKPVVVSTAT
GCLEVTTGVYPYTAWNTPWIHVNFQSAAAVIGGVEAAYKVLKKKGLIDEDIEFVAFGGDG
GTYDIGFQSLSAAAERGHNFLYVCYNNEGYQNTGYQKSSATPIGAYTKTTPVGSAKVGKQ
EPRKDLTMIMAAHGIPYVAQASPHIYRDLTRKVKKALTFKGPKFINTLQPCTLSWRFAPE
DTMRLAKLAVETRYWPVYEVINGKYWKVNIKPKRPKPIEEYISAQPRWKHVLKYPEIVER
IQKEIDDKWNHLLALEEMSKALAEKEGIDYEALFANPEDNKEGQ
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaaaagtaaccattcaagtattagcagatttagctcaagaaagagaggaaaaa
tatcattctcataatccattggctcctggtcatagaatgtgtatcggctgtggtattcca
ccaattgttaacgaagtgttattagctattgataagccagtagtagtatcaactgcaaca
ggttgccttgaagttacaacaggagtatatccatatacagcatggaatacgccatggatt
catgttaactttcagtctgcggcggctgtaattggcggtgtagaagctgcttataaagtt
cttaaaaagaaaggtttgattgatgaagatatagagtttgttgcatttggtggtgatggt
ggaacttacgatattggattccaatcattatctgcagcagcagaaagaggtcataacttc
ctttacgtttgctataacaacgaagggtatcaaaacacaggataccaaaaatcttctgca
acgcctattggtgcatatactaaaacaactccggttggttctgctaaagtaggaaagcaa
gagccaagaaaagacttgactatgattatggctgcacatggtataccttatgtagctcaa
gcatctcctcatatctatagagatttaacaagaaaagttaaaaaagctttaacttttaaa
ggtccaaaatttattaacacacttcaaccttgtactctttcttggagatttgctccagaa
gatacaatgagactcgcaaagcttgctgttgaaacaagatactggccagtgtatgaagta
atcaatggtaaatactggaaagtcaacattaaaccaaaaagaccaaaaccaattgaagag
tatatctcagctcagccaagatggaaacacgtattaaaatatccagaaatcgttgaaaga
attcaaaaagaaatagatgataaatggaaccatctattagctttagaagaaatgtctaaa
gcacttgctgagaaagaaggaatagattacgaagcacttttcgcaaatcctgaagacaat
aaagaaggtcaataa

DBGET integrated database retrieval system