KEGG   Sulfitobacter sp. D7: B5M07_05785Help
Entry
B5M07_05785       CDS       T05714                                 

Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
suld  Sulfitobacter sp. D7
Pathway
suld00220  Arginine biosynthesis
suld01100  Metabolic pathways
suld01110  Biosynthesis of secondary metabolites
suld01130  Biosynthesis of antibiotics
suld01230  Biosynthesis of amino acids
Module
suld_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:suld00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    B5M07_05785
Enzymes [BR:suld01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     B5M07_05785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: AYE85678
UniProt: A0A386TD03
Position
1196587..1197492
Genome map
AA seq 301 aa AA seqDB search
MNHFLDIHQTDPADLRQIIDNAAAMKAARQGRPRGAPDEDQPLKDHMVALIFEKPSTRTR
VSFDVGVRQMGGQTMVLSGADMQLGHGETIADTARVLSRYVDMIMIRTFEEQTLLDMAEH
ATVPVINGLTNRTHPCQIMADIQTFEEHRGPIKGRKVVWSGDGNNVFASFAHAAKQFDFD
LVFTGPEPLDPEAALDGLYTVERNPQKAVEGADLVVTDTWVSMHDPQSARERRHNQLRGY
QVNDALMALAKPDALFMHCLPAHRDDEATSSVMDGPHSVIFDEAENRLHAQKAVMRWCLG
A
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaaccattttcttgatatccaccaaaccgaccccgccgatttgcggcagatcatcgac
aacgccgccgccatgaaggccgcgcgccaaggccgcccgcgcggcgcgccggatgaagat
cagccgctgaaagaccacatggtcgcgctgatctttgaaaaaccttcgacccgcacgcgc
gtgtctttcgacgtgggcgtgcgtcagatgggcgggcagaccatggtcctttcgggggcg
gacatgcagcttggccatggagagaccatcgccgacaccgcccgcgtgctgtcacgctat
gtggacatgatcatgatccgcaccttcgaagagcagaccctgcttgatatggccgaacat
gctaccgtgccggtgatcaacgggctgaccaaccgcacgcacccctgccagatcatggcc
gacatccagacgtttgaggaacaccgcggcccgatcaaggggcgcaaggtggtctggtcg
ggcgacggcaacaatgtctttgccagctttgcccatgcggcgaaacagttcgactttgat
ctcgtctttaccggccccgagccgctggaccctgaagcggcgctcgacgggctttatacc
gtcgaacgcaatccgcaaaaggctgtcgagggcgccgatctggtggtgaccgacacatgg
gtcagcatgcatgatccgcaatcggcccgcgaacggcggcacaaccagctgcgtggctat
caggtgaacgacgcgctgatggcgctggcgaaacctgacgcgctcttcatgcattgcctg
cccgcccaccgcgatgatgaggcgacaagctcggtcatggatggcccgcattcggtgatc
tttgatgaggccgaaaaccgtctgcacgcccaaaaagccgtcatgcgctggtgtctgggg
gcatga

DBGET integrated database retrieval system