KEGG   Sulfitobacter sp. D7: B5M07_06230Help
Entry
B5M07_06230       CDS       T05714                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
suld  Sulfitobacter sp. D7
Pathway
suld00450  Selenocompound metabolism
suld00970  Aminoacyl-tRNA biosynthesis
suld01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:suld00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    B5M07_06230
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    B5M07_06230
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:suld01007]
    B5M07_06230
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:suld03016]
    B5M07_06230
Enzymes [BR:suld01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     B5M07_06230
Amino acid related enzymes [BR:suld01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   B5M07_06230
Transfer RNA biogenesis [BR:suld03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    B5M07_06230
 Prokaryotic type
   Other AARSs
    B5M07_06230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 DEP
Motif
Other DBs
NCBI-ProteinID: AYE85746
UniProt: A0A386TEH5
Position
complement(1290724..1292436)
Genome map
AA seq 570 aa AA seqDB search
MTRHLITSAIPYINGIKHLGNLVGSQLPADLYARYQRGRGQDVLFLCATDEHGTPAELAA
AKAGKPVEEYCAEMYETQARIAEGFGLSFDHFGRSSSPQNRKLTQHFAGALADQGLIEEV
SQRQIYSPTDGRFLPDRYVEGTCPNCGFEDARGDQCDNCTKQLDPEDLINPRSTISGATD
LEMRETKHLFLRQSKLKDELDDWINSKTDWPVLTTSIAKKWLHDGDGLQDRGITRDLSWG
VPVKRGDQDWPGMEGKVFYVWFDAPIEYIACAQEWVDTGKGSDWESWWRTDKGADDVRYT
QFMGKDNVPFHTLSFPATIKGSGEPWKLVDYIKSFNYLNYDGGQFSTSRGRGVFMDQALE
ILPADYWRWWLLSHAPETSDAEFTWENFQASVNKDLADVLGNFVSRITKFCRSKFGEAVP
EAGEYGEAEHALIEDITARVARYEALMEAMEVRKSAAELRGIWAAGNEYLQAQAPWTTFK
TDPDKAAAQVRLALNLIPLYAVLSAPFIPAASASMLEAMKVEDMPWPDNVPAALGKLAPG
HGFDVPEVLFAKISDEDRESWAERFAGKRD
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgacacgccacctcatcacctccgccatcccctatattaacgggatcaaacatctgggt
aaccttgtaggcagccaactgcctgcggacctttacgcgcgctaccagcgtggccggggg
caggatgttctgttcctctgcgccaccgacgaacacggcacccctgccgaactcgccgcc
gccaaagcgggcaaaccggtcgaggaatactgcgccgagatgtatgaaacacaggcccgc
atcgccgaaggctttggcctgtcgttcgaccactttggccgttcttcaagcccgcaaaac
cgcaagctgacccagcatttcgcgggcgcgctggcggatcaggggctgatcgaagaagtt
tcgcagcgccagatttactcccccactgatggccgcttcctgccggatcgctatgtcgaa
ggcacctgccccaactgcgggttcgaggacgcgcgcggcgatcaatgcgacaactgcacc
aagcagctcgaccccgaagacctgatcaatccgcgctccaccatctcgggcgcgaccgat
ctggaaatgcgcgagaccaagcatctgttcctgcggcagagcaagctgaaggacgagctg
gacgactggatcaattccaagaccgattggcccgtgctgaccacctccatcgccaagaaa
tggcttcatgacggcgatggtctgcaagaccgtggcatcacccgcgaccttagctggggc
gttccggtgaagcgcggcgatcaggattggccgggcatggagggcaaggtcttttacgtc
tggttcgacgcgccgatcgaatatatcgcctgcgcgcaggaatgggtcgatacgggcaaa
ggctctgactgggaaagctggtggcgcaccgacaagggcgcagacgacgtgcgctatacc
cagttcatgggcaaggacaacgtgcccttccacacgctcagctttccggccacgatcaag
ggctcgggcgagccgtggaagctggtggattacatcaaatccttcaactacttgaattac
gacggcggccagttctccacctcgcgcgggcgcggggtctttatggatcaggcgttggag
atcctgcccgcggattattggcgctggtggctgctcagccacgcacccgagacttcggat
gccgaattcacatgggaaaacttccaagcgtcggtgaacaaagatttggcagacgtgctg
ggcaacttcgtcagccgcatcaccaaattctgccgctccaaattcggcgaagccgtgccg
gaggctggggaatacggtgaggcggagcacgccttgatcgaagacatcaccgcccgcgtc
gcgcgttacgaggcgctgatggaggcgatggaagtccgtaaatccgccgccgaactgcgc
ggcatctgggcggctggcaacgaatacctgcaggcccaagcgccctggaccaccttcaag
accgaccccgacaaagcggcggcacaggtgcggctggcgctgaacctgatcccgctctat
gcggtgctatcggccccattcatccctgcggcttcggcctcgatgctcgaggcgatgaag
gtcgaagacatgccttggcccgataatgtgccagcggccttgggcaaactagcccccggt
catggctttgacgtgcccgaggtgctttttgccaagatcagcgatgaggaccgcgaaagc
tgggccgaacgcttcgccggcaagcgggattga

DBGET integrated database retrieval system