KEGG   Sulfitobacter sp. D7: B5M07_12115Help
Entry
B5M07_12115       CDS       T05714                                 

Definition
(GenBank) adenylosuccinate synthase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
suld  Sulfitobacter sp. D7
Pathway
suld00230  Purine metabolism
suld00250  Alanine, aspartate and glutamate metabolism
suld01100  Metabolic pathways
Module
suld_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:suld00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    B5M07_12115
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    B5M07_12115
Enzymes [BR:suld01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     B5M07_12115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: AYE86791
UniProt: A0A386TF35
Position
complement(2509199..2510494)
Genome map
AA seq 431 aa AA seqDB search
MANVVVVGAQWGDEGKGKIVDWLSERADVIARFQGGHNAGHTLVIDGKVYKLHALPSGVV
RGGKLSVIGNGVVLDPWHLLKEIETIEGQGVEISPENLMIAENTPLILPFHGELDRAREE
AASKGTKIGTTGRGIGPCYEDKVGRRAIRVADLADPATLEARVDRALQHHDPLRKGLGVE
AIDRDALIAQLQEIAPKILPFAAPVWKVLAEKRKAGKRILFEGAQGALLDIDFGTYPFVT
SSNVIAGQAATGVGLGPTAIDYVLGIVKAYTTRVGEGPFPTELEDADGQRLGERGHEFGT
TTGRKRRCGWFDAALLRQTCATSGITGICLTKLDVLDGFETLKVCVGYELDGERLDYLPT
AAEQQARCVPIYEELPGWSESTEGARSWADLPANAIKYVRRVEELIQCPVALVSTSPERE
DTILVTDPFAD
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggccaatgtcgtcgttgtcggcgcccaatggggtgacgagggaaaaggcaagatcgtt
gactggctcagcgaacgtgccgatgtgatcgcacgctttcaaggcgggcataacgcgggc
cacactctggtcatcgacggcaaggtttacaagctgcatgcgctgccttcgggcgtggtg
cgcggcggtaagctgtcggtcatcggcaatggcgtggtgctggacccgtggcacctgctg
aaagagatcgagacgatcgaaggtcagggcgtcgagattagccccgagaacctgatgatc
gcggaaaacacgccgctgatcctgccgttccacggcgaattggaccgcgcccgcgaagaa
gcggccagcaagggcaccaagatcggcaccaccggtcgtggcatcggcccctgttacgaa
gacaaagttggccgccgcgccatccgcgttgccgatctggccgaccccgcgaccttggaa
gcccgcgtcgatcgtgccctgcagcatcacgatccgctgcgcaaaggtttgggcgttgag
gccatcgaccgcgacgcgctgatcgcgcaactgcaagagattgcgccgaaaatcctgccc
ttcgccgcgccggtttggaaagtgttggccgagaagcgcaaggctggcaaacgcatcctg
ttcgaaggggcgcagggcgctctgctggacatcgacttcggcacctatccttttgtcacg
tcttccaatgtgattgcagggcaggcggcgactggcgtgggccttggccccaccgccatc
gattatgtgctgggcatcgtcaaagcctataccacacgcgtcggtgaaggcccgttcccg
accgaattggaagacgccgacggccagcgtttgggtgagcggggccatgaatttggcacc
accaccgggcgcaagcgccgctgcggttggtttgacgcggccctgctgcgccagacctgt
gccacctctggcataaccggcatatgcctgaccaagctcgacgtgctcgacgggtttgag
acgctgaaggtctgcgtgggctatgagctggatggcgaacgactcgactatctgccgacc
gctgccgaacagcaggcgcgctgcgtgccaatctatgaagaactgccgggctggtccgaa
tcgaccgaaggcgcgcgcagctgggccgacctgcctgccaatgcgatcaaatatgtgcgc
cgggtcgaagaattgattcaatgcccggtcgcgctggtctcaacctcgccagagcgggag
gacaccattctggtgaccgaccctttcgcggactga

DBGET integrated database retrieval system