KEGG   Sulfitobacter sp. D7: B5M07_14830Help
Entry
B5M07_14830       CDS       T05714                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
suld  Sulfitobacter sp. D7
Pathway
suld03010  Ribosome
Brite
KEGG Orthology (KO) [BR:suld00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    B5M07_14830
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:suld03011]
    B5M07_14830
Ribosome [BR:suld03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    B5M07_14830
  Bacteria
    B5M07_14830
  Archaea
    B5M07_14830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 KORA
Motif
Other DBs
NCBI-ProteinID: AYE87287
UniProt: A0A386TGG8
Position
complement(3034192..3034572)
Genome map
AA seq 126 aa AA seqDB search
MSKDKNPRRVADNEAMAKLRMLRTSPQKLNLVAALIRGKSVDKALTDLTFSKKRVAQDVK
KCLQSAIANAENNHNLDVDELIVAEAYVGKNLTMKRGRPRARGRFGKIIKPFAEITIKVR
QVEEQA
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggataagaatccccgccgcgtggcagacaacgaagcaatggcaaaactgcgc
atgcttcgcaccagcccgcagaaactgaacctggttgcagctttgatccgtggcaagtcc
gtggacaaagcgttgacagacctcaccttctccaagaagcgggtcgcgcaggacgtgaag
aaatgccttcagtccgcgattgccaacgccgagaacaaccacaacctggacgtcgatgag
ctcatcgtggccgaggcctatgtcggtaagaacctgaccatgaagcgcggtcgcccgcgt
gcccgtggccggttcggcaagatcatcaagccgtttgccgagatcacgatcaaagtgcgt
caagttgaggagcaagcctga

DBGET integrated database retrieval system