KEGG   Sulfitobacter sp. JL08: C1J05_00490Help
Entry
C1J05_00490       CDS       T05585                                 

Gene name
ribA
Definition
(GenBank) GTP cyclohydrolase II
  KO
K01497  GTP cyclohydrolase II [EC:3.5.4.25]
Organism
suli  Sulfitobacter sp. JL08
Pathway
suli00740  Riboflavin metabolism
suli00790  Folate biosynthesis
suli01100  Metabolic pathways
suli01110  Biosynthesis of secondary metabolites
suli02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:suli00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    C1J05_00490 (ribA)
   00790 Folate biosynthesis
    C1J05_00490 (ribA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    C1J05_00490 (ribA)
Enzymes [BR:suli01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     C1J05_00490 (ribA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydro2 DHBP_synthase
Motif
Other DBs
NCBI-ProteinID: AXI53180
UniProt: A0A345R6J3
Position
complement(104012..105106)
Genome map
AA seq 364 aa AA seqDB search
MSFAPDITELLARARADLRMGVPVVLVGTEGQAVLAMAAETTDAQRLADLHALGGTAVLA
ITARRAETLKARAYDGDIARITLPPDAGLPWVLGVADPADDLKSPMKGPLIAQRDGNAAL
HRMAVDLAKTARLLPAALILDLPQAADFAAKNSLTVVPAVLAEPLLARSSPLHPVVSARL
PMDVSEAGRLHIYRPEDGGEEHYAIEIGRPDRTKPVLARLHSACFTGDLMGSLKCDCGPQ
LRGALAQMGAEGTGVLLYLNQEGRGIGLANKMRAYSLQDQGFDTVEANHRLGFEDDERDF
RIGANILKSMGFSSVRLLTNNPAKVTSMENTGIRVVERVPLKVGQTAQNRNYLATKAAKS
GHIL
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgagttttgcacctgatatcaccgaattgctggcccgcgcccgtgccgatctgcgcatg
ggggtgcctgttgtgctggtgggcacggagggtcaggcggttctggcgatggctgcagaa
acgacagacgcgcagcgattggccgatctgcacgctttgggtggcacagcggtactggca
atcaccgcgcggcgcgccgaaacgctaaaagcacgtgcctatgacggtgatatcgcccgg
atcacattgccaccggatgccggtttgccgtgggttttgggggtggccgatccggcggat
gatctgaaatcaccgatgaaagggcccctgatcgcgcagcgtgacggcaatgccgccttg
catcggatggccgttgatcttgcaaagacggcccgcttgctgcccgccgcgctgatactc
gacttaccgcaggcggctgattttgccgccaaaaattcgcttactgtggtgccagcggtg
ttggcggagcccctgctggcacgatccagcccgctgcacccggttgtcagcgcgcgcctg
ccgatggatgtatccgaggcggggcgtctgcatatctatcggcccgaagatggcggcgag
gaacattatgctatcgaaatcggccgtccggaccgcacgaaaccggtgctggcgcgtctg
cattcggcctgtttcaccggcgatctgatgggcagcctgaaatgcgattgcggaccacaa
ttgcgtggcgcgctggcgcagatgggggccgagggcaccggggttcttttgtatctgaat
caggaagggcgcgggatcggtctggccaacaagatgcgcgcctattcgcttcaggatcag
gggttcgacacggtcgaggccaaccaccgccttgggtttgaagatgacgaacgcgatttt
cgcattggtgccaatattttgaaatcaatggggttttcctctgtccggttgctgacaaac
aatccggccaaggtgacatcgatggaaaataccggcatcagggtggtggaacgtgtgcca
ctaaaggtggggcaaaccgcgcagaaccggaattacctggccaccaaggcggccaaatcc
ggacatatcctgtga

DBGET integrated database retrieval system