KEGG   Sulfitobacter sp. JL08: C1J05_02345Help
Entry
C1J05_02345       CDS       T05585                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
suli  Sulfitobacter sp. JL08
Pathway
suli03010  Ribosome
Brite
KEGG Orthology (KO) [BR:suli00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    C1J05_02345
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:suli03011]
    C1J05_02345
Ribosome [BR:suli03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    C1J05_02345
  Bacteria
    C1J05_02345
  Archaea
    C1J05_02345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 KORA Caenor_Her-1
Motif
Other DBs
NCBI-ProteinID: AXI53495
UniProt: A0A345R7F8
Position
458535..458915
Genome map
AA seq 126 aa AA seqDB search
MSKDKNPRRVADNEAMAKLRMLRTSPQKLNLVAAMIRGKKVDKALTDLTFSKKRIAEDVK
KCLQSAIANAENNHNLDVDELVVAEAYVGKNLTLKRGRPRARGRFGKIVKPFSELTIKVR
QVEEQA
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggataaaaatccccgccgcgtggcagataacgaagcaatggcaaaactgcgt
atgctgcgtacttccccgcaaaaactgaaccttgtagcggccatgatccgcggcaagaaa
gtggacaaggccctgacggacctcacgttcagcaagaaacgcatcgcggaagacgtcaag
aaatgtctgcaatccgcaatcgccaatgccgaaaacaaccataacctggatgtggacgag
ctggttgtggccgaagcgtatgttggcaaaaacctgacactgaaacgcggccgtccgcgt
gcccgtggccggtttggcaagatcgtaaagccgttttcggaactgacgatcaaagtccgt
caagttgaggagcaagcctaa

DBGET integrated database retrieval system