KEGG   Sulfitobacter sp. JL08: C1J05_17605Help
Entry
C1J05_17605       CDS       T05585                                 

Gene name
gcvT
Definition
(GenBank) glycine cleavage system protein T
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
suli  Sulfitobacter sp. JL08
Pathway
suli00260  Glycine, serine and threonine metabolism
suli00630  Glyoxylate and dicarboxylate metabolism
suli00670  One carbon pool by folate
suli01100  Metabolic pathways
suli01110  Biosynthesis of secondary metabolites
suli01130  Biosynthesis of antibiotics
suli01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:suli00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    C1J05_17605 (gcvT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    C1J05_17605 (gcvT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    C1J05_17605 (gcvT)
Enzymes [BR:suli01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     C1J05_17605 (gcvT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C
Motif
Other DBs
NCBI-ProteinID: AXI56070
UniProt: A0A345RET3
Position
complement(3582199..3583323)
Genome map
AA seq 374 aa AA seqDB search
MSDLLHTALFDLHVELGAKMVPFAGYAMPVQYPMGVMQEHLHTRSAAGLFDVSHMGQVLL
RGASWDAVALAFEALAPVDVLGLADGRQRYGFFTNEKGGIEDDLMFARRGQDLFVVINAA
CKETDLRLMRAGLPADIMIEVLEDRALIALQGPKAETALARLDPAAANMRFMDAAPLDLN
GIAVWASRSGYTGEDGFEISVDQGDVEPLVRTLLEMEEVAPIGLGARDSLRLEAGLCLYG
QDMDAGTTPSSAALTWAIQKVRRAGGARAGGFPGADVILAEFETPSPSVRVGLSPQGRAP
MRSGVALFADETSDVQIGTVTSGGFGPSVQAPVAMGMLNRENAAAGTTVYGDVRGKRLPV
AVVKLPFVAAGFKR
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
gtgtcggatttgttgcatacggctttgtttgatctgcatgtggaactgggtgcaaaaatg
gtgccctttgccggatacgcgatgccggtgcagtatccgatgggcgtcatgcaggaacat
ttgcacacgcgcagtgccgcaggcctgttcgatgtcagccatatgggtcaggtgctgttg
cgcggagcgtcctgggatgcggttgccctggccttcgaagcgctggcgccggtggatgtt
ctgggattggcagacgggcggcaacgctacgggttctttaccaatgaaaagggcgggatc
gaagacgatctgatgttcgcgcgccgtggtcaggatctgtttgtcgtgatcaatgccgcg
tgtaaggaaaccgatctgcgactgatgcgggcgggtttgcctgctgatatcatgatcgag
gttctggaggatcgcgctcttatcgcgttgcagggcccgaaggcagaaactgcacttgcc
cgtctggatcctgctgcggccaacatgcggttcatggatgccgcgcctttagatctgaac
ggaattgccgtctgggcctcccgatcggggtacacgggcgaggacgggttcgaaatttcg
gttgatcagggcgatgtcgaacccctggtacgcaccctgctggagatggaagaggttgcg
cccataggtcttggtgcgcgcgacagcctgcggcttgaggccggtctgtgcctttacgga
caggatatggatgctggcaccacaccttcatctgccgctctgacttgggccatccaaaag
gtgcgccgcgcgggcggtgcgcgggcaggcggatttcccggtgccgatgtgatacttgcc
gaattcgaaacgccgtcgccatccgtgcgcgtcggtctgtcaccgcaggggcgcgcgccc
atgcgcagcggcgtcgcgcttttcgccgatgaaacatccgatgttcagatcgggactgtc
acctctggcgggtttggccccagtgtgcaggcccccgttgccatgggcatgctgaaccgc
gaaaacgccgcagccggcacaaccgtttacggcgatgtgcggggcaaacgcctgccggta
gcggttgtcaaactgccctttgtggcggcgggtttcaaacgttaa

DBGET integrated database retrieval system