KEGG   Sulfurospirillum sp. JPD-1: SJPD1_2399Help
Entry
SJPD1_2399        CDS       T05109                                 

Definition
(GenBank) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
sulj  Sulfurospirillum sp. JPD-1
Pathway
sulj00230  Purine metabolism
sulj00250  Alanine, aspartate and glutamate metabolism
sulj01100  Metabolic pathways
Module
sulj_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:sulj00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SJPD1_2399
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SJPD1_2399
Enzymes [BR:sulj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     SJPD1_2399
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: ATB70495
UniProt: A0A290HGH7
Position
complement(2327519..2328766)
Genome map
AA seq 415 aa AA seqDB search
MKADMIVGIQWGDEGKGKIVDLMAQHYDVVCRYQGGHNAGHTIWVDGVRYALHLIPSGIL
NPKALNVIGNGVVVCPDALIKEMAQFEKLAGRLFVSDKAHMILNHHILIDQAKEKLRGAK
AIGTTGRGIGPSYGSKIERSGHRLGELRDTNKLARALVEFYDENRALFNALGIVTPDFET
LKSELDGYAKALLPFLTDTTHMVWKCLDENKKVLLEGAQGTMLDVDHGTYPFVTSSNTIS
AGACVGLGLNPKDIGKVTGIVKAYCTRVGNGPFPTEDFGAEGDELREKGHEYGTSTGRAR
RCGWFDAVACRYASRINGCDDLAIMKLDVLDGFETVKVCVAYEVNGQRVETLPQDLDNVK
PIYEELPGWKSVVGCRKFEDLPEAAKTYLKRLEVLTGTKIGLISTSPDRNDTIIL
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgatatgatcgtaggaattcaatggggtgatgaaggaaagggtaagatcgtt
gaccttatggcacaacactatgatgtcgtgtgccgttatcaaggcggtcacaatgcaggt
cacacgatctgggtagatggtgtacgttatgcacttcacttgattccttctggtatttta
aatccaaaagcactcaatgtcattggcaatggagtcgttgtttgtcctgatgcactcatt
aaagagatggcacaatttgaaaaacttgcaggtcgtttgtttgtcagtgacaaagcacat
atgattcttaatcatcatattttaattgaccaagccaaagaaaaacttcgtggcgctaaa
gcgattggtacaacaggacgaggcattggacctagttacggtagtaaaattgagcgtagc
ggacaccgtttaggagaactaagagacacgaacaaacttgcacgtgccttggttgaattt
tacgatgaaaacagagcgctctttaatgccctcggtattgtaacgcctgattttgagaca
cttaaaagtgagttagacggctatgctaaagcccttttacctttcttaacagatacgaca
catatggtttggaaatgtctggatgaaaataaaaaagtattactagagggtgctcaaggt
acaatgctcgatgtggatcatggaacctatcctttcgtaacaagctccaacacaatcagt
gcgggcgcatgtgttggcttgggactcaatcctaaagatattggcaaagtgacaggtatt
gtcaaagcgtactgcacccgtgtaggaaatggaccattccctacagaagactttggagca
gagggcgatgaattacgtgaaaaagggcatgaatacggtacttccacaggacgtgcacgc
cgttgtggttggttcgatgccgttgcctgccgatatgccagtcgcatcaatggctgtgat
gatcttgccatcatgaagctcgatgtattagatggttttgaaaccgttaaagtctgcgtt
gcttatgaagtaaacggccaaagagttgaaacgttgccacaagatttggataacgttaaa
ccaatttatgaagagttaccaggttggaagagtgttgtgggatgtcgtaaatttgaagat
ctccctgaagctgctaaaacgtatcttaaacgccttgaagtcttgacaggcacaaaaatt
ggacttatctcaacaagtcctgatagaaacgacacaattatattgtaa

DBGET integrated database retrieval system