KEGG   Candidatus Sulfuricurvum sp. RIFRC-1: B649_02695Help
Entry
B649_02695        CDS       T02537                                 

Definition
(GenBank) hypothetical protein
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
sulr  Candidatus Sulfuricurvum sp. RIFRC-1
Pathway
sulr00471  D-Glutamine and D-glutamate metabolism
sulr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sulr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    B649_02695
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sulr01011]
    B649_02695
Enzymes [BR:sulr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     B649_02695
Peptidoglycan biosynthesis and degradation proteins [BR:sulr01011]
 Precursor biosynthesis
  Racemase
   B649_02695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race DUF655
Motif
Other DBs
NCBI-ProteinID: AFV96853
UniProt: K7S2N3
Position
complement(519223..519969)
Genome map
AA seq 248 aa AA seqDB search
MRVGVFDSGVGGLSVVKSLLEHKLFEEIIYFGDTARVPYGVKDQNTIIRYSLEALEFFKN
FEIDLLITACNTVSAYALDEMREHSDCDVIGVVDPGVLALKNAIPSTDANILILGTKATV
KSGAYEKGLRKLGYQNLSAIATSLLVPIVEEGLYEGEVLQSALHHYFGSLNKRPDAVILG
CTHFPLVATAINNYFEGKSTLIHSGEAIVEYLESHYDFTKRFEETSLKFFASENPEGLRR
VAKEWLSL
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagagtcggcgtctttgatagcggtgtcggaggattaagcgtcgtcaaatcgttgttg
gagcataaactctttgaagagattatctacttcggcgatactgcccgcgtcccctacggc
gtcaaagatcaaaacactatcatccgctactccctcgaagccctcgaatttttcaaaaac
tttgaaatcgatctgttgatcactgcatgtaataccgtcagtgcttatgcccttgatgag
atgagagagcacagtgactgtgacgtaatcggagtggtcgatccgggagtgttggcactc
aaaaacgccatcccctcaaccgatgccaatattctgattctcggcaccaaagcgaccgtc
aaatcgggagcctatgaaaaagggcttcgtaagctcggataccaaaatctcagcgctatt
gcaacttcgttactggttcctatcgtcgaagaaggactctatgagggtgaagtactccaa
agcgcattgcatcattatttcggttcattaaacaaaagacccgatgcggttatccttgga
tgcacccattttccactcgttgctactgcgattaacaactatttcgaagggaaaagcacc
cttatccactcgggtgaagcgatcgtcgaatatttagagagccattacgattttacgaaa
cgatttgaggaaaccagcctcaaattttttgcctccgaaaatcccgaagggcttcgccgc
gttgccaaagagtggctgtcactgtaa

DBGET integrated database retrieval system