KEGG   Sulfurospirillum sp. SL2-1: Sdiek1_0257Help
Entry
Sdiek1_0257       CDS       T04910                                 

Definition
(GenBank) Nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
suls  Sulfurospirillum sp. SL2-1
Pathway
suls00230  Purine metabolism
suls00240  Pyrimidine metabolism
suls01100  Metabolic pathways
suls01110  Biosynthesis of secondary metabolites
suls01130  Biosynthesis of antibiotics
Module
suls_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
suls_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
suls_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:suls00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Sdiek1_0257
   00240 Pyrimidine metabolism
    Sdiek1_0257
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:suls04131]
    Sdiek1_0257
Enzymes [BR:suls01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     Sdiek1_0257
Membrane trafficking [BR:suls04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    Sdiek1_0257
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: ARU47440
UniProt: A0A1Y0HHK0
Position
239912..240325
Genome map
AA seq 137 aa AA seqDB search
MENTLSIIKPDAVAKNVIGKIVDRFESNGLKIAAMKKVQLSQADAEAFYAVHASRPFFGD
LVKFMISGPVVVMVLEGENAVLKNRDLMGATNPKEAAKGTIRADFADSIDANAVHGSDSL
ENAKNEINFFFARREIL
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
gtggagaacacattatccattattaaaccagatgcagtagcaaaaaatgttattggtaaa
attgttgacagatttgaatcaaatgggttaaaaattgcagcgatgaaaaaagtccaactt
agtcaagcagatgctgaggctttttatgcagtgcatgcaagtagaccattttttggtgat
cttgttaaatttatgatcagtggacctgttgtggttatggttctagaaggcgaaaatgcc
gttcttaaaaatcgtgatcttatgggtgcaacgaatcctaaagaagcagcaaaaggtact
attagagctgattttgctgacagtattgatgcaaatgcagtgcatggtagcgatagttta
gaaaatgcaaaaaacgaaattaatttcttttttgctagaagagaaattctctaa

DBGET integrated database retrieval system