KEGG   Sulfurospirillum sp. SL2-1: Sdiek1_1446Help
Entry
Sdiek1_1446       CDS       T04910                                 

Definition
(GenBank) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
suls  Sulfurospirillum sp. SL2-1
Pathway
suls00970  Aminoacyl-tRNA biosynthesis
suls01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:suls00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Sdiek1_1446
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:suls03029]
    Sdiek1_1446
Enzymes [BR:suls01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Sdiek1_1446
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Sdiek1_1446
Mitochondrial biogenesis [BR:suls03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Sdiek1_1446
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey DUF2226
Motif
Other DBs
NCBI-ProteinID: ARU48610
UniProt: A0A1Y0HKX0
Position
1381385..1382815
Genome map
AA seq 476 aa AA seqDB search
MKFEVVIGLEVHAQLNTKTKIFCSCPTSFGDEPNTNVCEVCLGLPGSLPVLNKEAVKKAI
ALGTAINATINQKSIFNRKNYFYPDLPKGYQISQFEIPIVEAGEIYIDFEDGTTKRIGVT
RAHLEEDAGKNIHHGSVSHVDLNRAGTPLLEIVSEPDMRSSEEAILYLKKLHAILRYLDI
SDANMQEGSFRCDANVSIRPKGDTKLYTRAEIKNLNSFKFIQKAIDYEVERQSNAWEDGV
YEREVVQETRLYDIDKDETRSMRSKEDSAEYRYFPDPDLLPVLIPDDMLAECIQIPELPD
QKRDRFLKEYGIKEYDANVITSSVEMAQFYETMIQEGAGAKNSVTWLTVELLARLSHGVT
LTTSPVDAVKLASIVKRIEDGTISGKAAKEVLDYLMQNSTHVDDAIEKLGLKQVSDDGAI
LAIIDAIISANADKVAEYRSGKDKLFGFFVGQTMKESKGTANPTKVNELLKSRLDV
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgaagtcgttattggactagaagttcatgctcaattaaacactaaaaccaag
attttttgcagttgccccaccagctttggcgacgaacccaataccaatgtgtgtgaagtc
tgcttaggacttccaggctcactgcctgttttaaacaaagaagcggtgaaaaaagccatc
gcgcttggtacagctatcaatgcgaccatcaatcaaaaatctatttttaaccgtaaaaat
tacttctatcccgatcttccaaaagggtatcaaatcagccaatttgagatacctatcgtt
gaagcgggtgaaatttatattgactttgaagatggtacaacgaagcgtattggagtcact
cgtgcgcaccttgaagaggatgctggtaagaacatccatcatggtagtgtctctcatgta
gatttaaatcgcgcgggtacaccacttcttgagatcgttagtgaacccgatatgagaagc
agtgaagaggcaattttgtaccttaaaaaattgcatgcgattttgcgttacctcgacatc
agtgatgcaaatatgcaagagggaagtttccgctgtgatgcgaacgtttccattcgcccc
aaaggtgatacgaagctttatactagagcagagattaaaaacctaaattcatttaagttt
attcaaaaagcgattgattatgaagttgaacgtcaaagtaatgcatgggaagatggcgtg
tatgaacgagaagtggttcaagaaacgcgtctttatgacattgataaagacgaaacacgc
agtatgcgttctaaagaagacagtgcagagtatcgctatttcccagatcctgacctattg
ccagtgcttattcctgatgatatgctcgcagagtgtatccaaattccagaactccccgat
caaaagcgtgatcgtttccttaaagagtatggtattaaagagtacgatgccaatgtaatt
acatccagtgttgaaatggctcaattttatgagacaatgatccaggagggtgcaggagcc
aagaactctgtgacatggctcaccgtagagcttttagcacgtttgagtcatggtgtgacc
cttaccacttcacctgttgatgccgtaaaattagcctctattgtcaaacgcattgaagat
ggaaccattagtggcaaagcggcaaaagaggttcttgattatttgatgcaaaacagtacc
catgttgatgacgccattgaaaaacttggactgaaacaagtgagtgatgatggtgcaatt
ttggcaattattgatgccattatcagtgccaatgctgataaagtagcagagtatagaagt
ggtaaagataaactttttggtttctttgtaggacaaacgatgaaagagagcaaagggact
gcaaatcctacaaaagtgaatgaacttttaaaatctagacttgatgtataa

DBGET integrated database retrieval system