KEGG   Sulfurospirillum sp. SL2-1: Sdiek1_1448Help
Entry
Sdiek1_1448       CDS       T04910                                 

Definition
(GenBank) Beta-hexosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
suls  Sulfurospirillum sp. SL2-1
Pathway
suls00520  Amino sugar and nucleotide sugar metabolism
suls01100  Metabolic pathways
suls01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:suls00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Sdiek1_1448
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Sdiek1_1448
Enzymes [BR:suls01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Sdiek1_1448
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: ARU48612
UniProt: A0A1Y0HKM1
Position
1383761..1384717
Genome map
AA seq 318 aa AA seqDB search
MYAKTPSLEEMIAQMIVIGFEGVKEGDKWVDQIAKDIKREKIGGILLTDKNIQNPAQLKK
LNDYLKAEAPKGLPLIVAVEQEGGENSILSAKKGFSEIPSAARLFKTKDIAEAEDLYKKL
SSDLTKAGINVDLAPVLDLQPKRDNLDSPKVQRSYSSYEEIVTTYAMLLINALHADGVTP
VVKYFPTAGANLWNNFSSEEDVTNTWRFEQLKPYYDLIAFGKMDAVLISHIMQKEIDPKN
PALFSKLVIQGLLRDKMHFEGVVFADNFRTSSISSSIDFKQRIIRSIDAGVDIIIMPNYF
SENASTPLTIQKNYYRCY
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgtatgcaaaaacaccttcgctcgaagagatgattgcccaaatgattgtgattggtttt
gaaggggtaaaagaaggcgataaatgggtggatcagattgctaaagatattaagcgcgaa
aaaattggtggaattcttttaaccgataaaaatatccaaaatccagcacaactgaaaaaa
ctcaatgattatttaaaagctgaagcaccaaaaggattgccactgattgttgctgtcgaa
caagagggtggtgaaaatagtatattgagtgctaaaaaagggtttagtgaaattccttct
gctgctagactttttaagacaaaagatattgctgaggcggaagatctttataaaaaattg
agcagtgatcttacaaaagcaggtattaatgtagatcttgcaccggttttagatcttcaa
cctaaacgagataatctcgatagccctaaggtgcaacgcagctactctagttatgaagaa
attgtgacaacctatgcaatgcttttaatcaatgctctccatgcggatggtgtgacacct
gttgtgaagtattttcctacggcgggcgctaatctttggaataatttttccagcgaagaa
gatgtaacgaatacatggcgcttcgagcagctcaaaccctattatgatttaattgctttt
gggaagatggatgctgttttgatctcacatattatgcaaaaagagattgatcctaaaaac
ccagcactgttttcaaaattggttattcaaggattgcttagagataaaatgcattttgag
ggagttgtctttgctgataatttccgaacaagctcaatttccagcagtattgattttaaa
cagcgtattattcgaagtattgatgcaggagttgatattatcattatgcctaattatttc
tctgaaaatgcgagcactcctttgacaattcaaaaaaattattacagatgctattaa

DBGET integrated database retrieval system