KEGG   Sulfitobacter sp. SK012: C1J03_00570Help
Entry
C1J03_00570       CDS       T05563                                 

Definition
(GenBank) amidohydrolase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
sulz  Sulfitobacter sp. SK012
Brite
KEGG Orthology (KO) [BR:sulz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C1J03_00570
Enzymes [BR:sulz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     C1J03_00570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: AXI44653
UniProt: A0A345QH66
Position
115772..116602
Genome map
AA seq 276 aa AA seqDB search
MKTALVQLSVSDDPAANLPITLAHIENAASQGAAFVLLPEVANCISTSRRHQQEVLQSEE
DDITLAALRGAAANHSIWLLIGSLALKTEDPDGRFANRSFLIDPEGQIAARYDKIHMFDV
QINETETFRESSSYRPGTQAVVAKTPFANIGMSVCYDVRFPELYQKLVGAGAQIITVPAA
FSPVTGAAHWHSLLRARAIETGCYVLAPAQTGEHASALHKTRHTYGHALAVSPWGEVLID
AECEEGIYMFDLDMEHVSNARAKVPSLKHKREFKGP
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgaagacagcgcttgtccagcttagcgttagcgatgatccggcggcgaacctgccgatc
acattggcgcatattgaaaacgcggcatctcagggtgccgcgttcgtcctgttgcccgaa
gtagcgaattgcatttctaccagccgtcggcatcagcaagaagttttgcaaagcgaagaa
gacgatatcacgctggccgcgctgcgaggtgctgccgcgaatcacagcatctggcttttg
atcgggtcccttgcgctcaagactgaggatcctgatggccgttttgcaaaccggtctttc
ctgattgatccagagggtcagatcgcggcgcgctatgataagatccacatgttcgatgtg
cagattaatgagaccgaaacgttccgcgaatcgagtagttaccgcccaggcacacaggcg
gttgtggcaaaaacaccctttgccaatatcggaatgtcagtatgttacgatgttcgcttc
ccggagctttaccaaaaactagtgggagcgggtgctcagatcattaccgttccagcagct
ttttcgcccgttacaggtgctgcgcattggcatagcctgttgcgcgcccgcgcgatcgag
acggggtgctatgtccttgcgcctgcacaaacgggagagcacgcgagcgccctccataag
acgcgtcatacatacggtcacgcgctggcagtctctccttggggagaggtattgattgac
gcagaatgcgaagaaggcatttacatgtttgatctcgacatggaacatgtttcaaatgcg
cgggctaaggtgcccagtctgaaacacaagcgagaattcaaaggtccgtga

DBGET integrated database retrieval system