KEGG   Sulfitobacter sp. SK012: C1J03_20375Help
Entry
C1J03_20375       CDS       T05563                                 

Definition
(GenBank) esterase
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
sulz  Sulfitobacter sp. SK012
Pathway
sulz00903  Limonene and pinene degradation
sulz00930  Caprolactam degradation
sulz01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sulz00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C1J03_20375
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    C1J03_20375
Enzymes [BR:sulz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     C1J03_20375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 Say1_Mug180 COesterase
Motif
Other DBs
NCBI-ProteinID: AXI48148
UniProt: A0A345QS61
Position
complement(4180394..4181308)
Genome map
AA seq 304 aa AA seqDB search
MSVARLLLNQWFMRVEKRRMRNAIGPMELRYNFEKQARLLFHAPRGTTKRWTALGGVDTL
ELTPRHVQQDRVILYFHGGGFVFGSPETHAALAAQLAHRVKGRALLPRYRLAPEAVFPAA
ALDVRAAWDGLIADGVDPAHVVIGGDSAGGALAFGLLAQLCSEGAPMPGAVFGFSPLTDM
THSGESFVANAECDVILPAERAGEMAEIFLNGQPPDDPRCSPLHGQFHGAPPTWFTVGDT
EILRDDARRLADVLRRDGAPVNLVERHDLPHVWPLMHNILPEARETLDALAEWIKQVQGW
PTES
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgagtgttgcgcgccttctactcaatcagtggtttatgcgggttgaaaagcgccgaatg
cgcaacgccatagggcccatggagttgcggtataattttgaaaaacaggcgcgcctgtta
tttcacgccccaaggggcacgacaaagcgttggaccgcccttggcggcgtcgacactttg
gaacttaccccccgccacgtccaacaggatcgggtcattttgtacttccatgggggtggg
tttgtttttggcagccccgaaactcatgccgccctcgcagctcaacttgcccaccgggtg
aaggggcgtgcacttctgcctcgctaccgtcttgcccctgaggccgtttttcctgctgcc
gcgctggatgtccgggctgcttgggacgggttgatcgctgatggggttgatccggcgcat
gtggtcattggtggcgatagcgcgggtggcgcgctggcctttggcctgttggcacagctt
tgtagcgaaggcgcgccaatgcctggcgcggtgtttggcttttctcctctgacggatatg
acccactccggcgagagctttgtggcgaatgcagagtgcgatgtcatattgccagccgag
cgggctggtgaaatggcagaaatattcttgaacggccagcctcccgacgacccgcgctgc
agtccgctccatggtcaattccatggcgctccgccaacttggtttaccgtgggcgatacc
gaaattttgcgagatgatgcgcgcaggctagcggatgttttgcgccgtgatggtgccccc
gtaaatctggtcgagcgtcacgatctaccgcatgtttggcccctcatgcataacattctg
cccgaggcacgcgagactttggatgcgctggcagagtggatcaagcaagtgcaaggctgg
ccaaccgaaagctga

DBGET integrated database retrieval system