KEGG   Candidatus Sulcia muelleri CARI: SMCARI_204Help
Entry
SMCARI_204        CDS       T01303                                 

Gene name
sucB
Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sum  Candidatus Sulcia muelleri CARI
Pathway
sum00020  Citrate cycle (TCA cycle)
sum00310  Lysine degradation
sum01100  Metabolic pathways
sum01110  Biosynthesis of secondary metabolites
sum01120  Microbial metabolism in diverse environments
sum01130  Biosynthesis of antibiotics
sum01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sum00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SMCARI_204 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    SMCARI_204 (sucB)
Enzymes [BR:sum01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SMCARI_204 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ADM90003
UniProt: E0TJM6
Position
209762..210877
Genome map
AA seq 371 aa AA seqDB search
MILEIKVPSPGESITEVEISSWLFKNGDFVKKNQVIAEIDSDKATLEICAEESGMLIIKA
KKGDILKVGEILCLIDTSFSKEKRNFIAPSTIKRLNQYKIDKKKIISKNKKYDAIKKIPS
MGTKNLINRSFDITKLSKLRRKLSERLVSVKNETAMLTTFNEVDMSNIFFLRKKYKNVFK
EKHGVKLGLMSFFVKSCIIALKKYPDINSMIDGENKINFKYYDISIAVSGPKGLMVPVIR
NADTLSFRGIENTIKNLSNSIKNSTISIDDLTGGTFTITNGGIFGSMLSTPIINPPQSAI
LGMHNIVERPIVKLGKLEIRPIMYLALSYDHRIIDGKEAVGFLLSIKESIENPIKNLIGS
EENLKNSFELK
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgatattagaaataaaagttccttctccaggagaatcaataacagaagttgaaatatca
tcttggttatttaaaaatggtgattttgttaaaaaaaatcaagttattgcagaaatagat
tcagataaggctactttagaaatctgtgcagaagaaagtggaatgttaattataaaagct
aaaaaaggagatattttaaaagtaggagaaatattatgtttaatagatacttctttttca
aaagaaaaaagaaattttattgctccatcaacaataaaaagattaaatcaatataaaatt
gataaaaaaaaaattatttcaaaaaataaaaaatatgatgctattaaaaaaattccatct
atgggaactaaaaatttaattaatagatcttttgacataacaaagttatctaaacttaga
cgtaaattatcagaaagacttgtttccgtaaaaaatgaaacagctatgcttactactttt
aacgaagtagatatgagtaatatcttttttttaagaaaaaaatataaaaatgtttttaaa
gaaaaacatggagttaaattaggattaatgtctttttttgtcaaatcttgtataatagcg
ttaaaaaaatatccagatattaattctatgatagatggggaaaataaaataaattttaaa
tattatgatataagtattgcagtatctggaccaaaaggtttgatggtcccagttattaga
aatgctgatactctttcttttagaggaatagaaaatactataaaaaatttatctaatagt
ataaaaaattcaactatatctatagatgatcttactggaggtacttttactataacaaat
ggaggcatttttggatctatgttatctactcctataataaatcctccccaaagtgctata
ttaggtatgcataatatagtagaaagacctatagtaaaattaggaaaactagaaattaga
ccaattatgtatttagcattatcttatgatcatcgtataatagatggaaaagaagcagtg
ggatttttattatcaataaaagaatcaatagaaaatcctattaaaaatttaataggatca
gaagaaaatttaaaaaattcttttgaattaaaataa

DBGET integrated database retrieval system