KEGG   Sulfurovum sp. NBC37-1: SUN_0144Help
Entry
SUN_0144          CDS       T00572                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
sun  Sulfurovum sp. NBC37-1
Pathway
sun00900  Terpenoid backbone biosynthesis
sun01100  Metabolic pathways
sun01110  Biosynthesis of secondary metabolites
sun01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sun00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SUN_0144
Enzymes [BR:sun01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     SUN_0144
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C
Motif
Other DBs
NCBI-ProteinID: BAF71104
UniProt: A6Q6J5
Position
complement(147216..148289)
Genome map
AA seq 357 aa AA seqDB search
MSIVLLGSTGSIGVNTLIVAEHYNIAIEALVAGNNIDLLNQQIAVHQPKLVAIANKADRD
RVNHPRVFCGTEGILEVIERSQSRTVVNALVGYAGLAPTLKATSLGKKVALANKESLVVA
GEFINMSLITPIDSEHFGLWYLMNDRPFSKLYITASGGAFRDWELNKMKDATFSDALKHP
NWSMGNKITIDSATMTNKLFELLEAKWLFDTSNIDAVIEKRSVIHALVEFVDGSTTAHFA
GVDMKLPIAFALKGEVTKEILPPTNLLGIGSLEFLPIEATRYPIWNIKEHILQNPHLGVV
VNAANEVAIKAFQKEKCSFVGMSEMVLDAYKKFEDVKAKNIEEIIQIDREVRHYVSH
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgtccattgttcttcttggttccaccggctctatcggggtcaataccctcattgttgca
gaacactacaacatcgctatcgaagcactggtagcagggaacaatatcgacctgcttaat
caacagatcgcagtacaccagcccaaattggtcgccatcgccaataaggctgacagggac
agggtcaaccacccccgtgtgttctgtggcactgaaggcatactcgaagtcatagaacgg
tcacaaagtcgtacagtggtcaatgccctggtaggctatgccggcctcgctcccacactc
aaagcaacctctctggggaaaaaagtagccctggcgaacaaagaatccctcgtcgttgcc
ggagaattcatcaatatgtcgctcatcacccccatcgactccgaacatttcggactctgg
tacctgatgaacgatcgtcccttctccaaactctacatcaccgcaagcggcggtgctttc
cgggactgggaactgaacaaaatgaaagatgccactttctctgatgcacttaaacatccc
aactggtccatgggaaacaagatcaccatcgactctgcgaccatgaccaacaaactcttc
gaactgcttgaggccaaatggctttttgacacttccaatatcgatgcggtgattgaaaag
agatcggtcatccatgccctggtcgaatttgtcgacggctctacaacagcgcactttgcg
ggagtggatatgaagctgcccatcgcttttgcactcaagggcgaagtaaccaaagaaatc
ctgccgccaacaaaccttctgggtatcggatcgctggaatttctgcccatagaagctacc
cgttaccccatctggaatatcaaagaacacatattgcagaacccacatctcggtgtggtg
gtcaatgccgccaatgaagttgccatcaaagctttccagaaagagaaatgctcctttgtc
gggatgagcgagatggttttggatgcctacaaaaaatttgaggatgtaaaggcgaagaat
attgaagagatcatccagatagacagggaggtgagacattatgttagccactaa

DBGET integrated database retrieval system