KEGG   Sulfurovum sp. NBC37-1: SUN_0200Help
Entry
SUN_0200          CDS       T00572                                 

Gene name
porA
Definition
(GenBank) pyruvate:ferredoxin oxidoreductase, alpha subunit
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
sun  Sulfurovum sp. NBC37-1
Pathway
sun00010  Glycolysis / Gluconeogenesis
sun00020  Citrate cycle (TCA cycle)
sun00620  Pyruvate metabolism
sun00633  Nitrotoluene degradation
sun00640  Propanoate metabolism
sun00650  Butanoate metabolism
sun00680  Methane metabolism
sun01100  Metabolic pathways
sun01120  Microbial metabolism in diverse environments
sun01130  Biosynthesis of antibiotics
sun01200  Carbon metabolism
Module
sun_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sun00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SUN_0200 (porA)
   00020 Citrate cycle (TCA cycle)
    SUN_0200 (porA)
   00620 Pyruvate metabolism
    SUN_0200 (porA)
   00640 Propanoate metabolism
    SUN_0200 (porA)
   00650 Butanoate metabolism
    SUN_0200 (porA)
  Energy metabolism
   00680 Methane metabolism
    SUN_0200 (porA)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    SUN_0200 (porA)
Enzymes [BR:sun01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     SUN_0200 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C TPP_enzyme_N YARHG DUF3341
Motif
Other DBs
NCBI-ProteinID: BAF71160
UniProt: A6Q6Q1
Position
204612..205844
Genome map
AA seq 410 aa AA seqDB search
MAEKFDLNDREVWDGNYAASQALRQAQIDVVAAYPITPSTPIVENYGAYVANGYVDGEYV
MVESEHAAMSGCVGASAAGGRVATATSSQGFALMVEVLYQASGMRLPIVLNVVNRALASP
LNVRGDHGDMYLGRDSGWIQIDAFNAQEAYDLVLCAFKIGEDHSVRLPVMVHQDGFITSH
TAQNIYPLTDEAAYNFIGDFQPVDDLLDFSRPVTYGAQTEEDWHFEHKAKQHKALMDSRP
VIDEVFAEFEKLSGRKYNRVETYMMEDADVVIVGLGSTVETAIVAAEELREEGVKAGVVG
IRVFRPFPFDQVREALKGAKAIAVLDRSSPGGAMGAFFNEVSAALYSTDTRPLVTNYIYG
LGGRDFSIDEAKRIFKEQQANADAGHITTDIQQFSGLRGPHLGYFQTQRG
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaaatttgatttaaatgacagagaagtctgggacggtaactatgctgcttcc
caggcactgagacaggcacagattgatgttgttgcggcgtatcctattacgccttcaacc
cctattgttgaaaattatggagcctatgtagcgaacggatatgttgacggtgaatatgta
atggtcgagtctgaacatgcagctatgtccggatgtgtaggtgcttctgcagcaggcgga
cgtgtcgctacggctacttcttctcagggattcgcccttatggtcgaggtactataccag
gcatccggcatgagactccctatcgtactaaacgtggtaaacagagcattggcttcgccg
ttgaatgtacgtggtgaccatggcgacatgtatcttggtagagattccggttggatccag
atagatgcattcaatgcacaggaagcttatgacttggtattatgtgcatttaagattggt
gaggaccactcggtaagactgccggtcatggtacatcaggacggattcatcacttcgcat
acggctcagaatatctatccgttgacagatgaggcggcatataacttcatcggtgatttt
cagccggttgatgatcttcttgatttctccagacctgtgacgtacggtgcacagacggaa
gaagactggcactttgagcataaagcgaagcagcataaagcgctgatggattcacgcccg
gttatcgatgaggtttttgccgaatttgagaaactcagcggaagaaaatacaacagggtt
gaaacctatatgatggaagatgccgatgttgttatcgtgggactaggtagtacggttgag
acggcaattgtggcagcggaagagttgagagaagaaggtgtcaaagcgggtgtagttggg
atcagagtattcagaccgttcccgttcgatcaggtaagagaagcacttaaaggtgccaag
gcgatcgccgttctggacaggtcaagcccaggcggtgcgatgggggccttcttcaacgaa
gtgtccgcagcactctattcaacagatacgagaccgcttgtaacgaactatatctacggt
cttggcggacgtgatttttccatcgatgaagcaaaaagaatatttaaagagcagcaggca
aatgcagatgctggacatattacaacagatatccaacagttctcaggacttagaggtcca
caccttggatacttccaaacacaaagaggttaa

DBGET integrated database retrieval system