KEGG   Sulfurovum sp. NBC37-1: SUN_0487Help
Entry
SUN_0487          CDS       T00572                                 

Definition
(GenBank) glutamyl-tRNA amidotransferase subunit C
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
sun  Sulfurovum sp. NBC37-1
Pathway
sun00970  Aminoacyl-tRNA biosynthesis
sun01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sun00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SUN_0487
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sun03029]
    SUN_0487
Enzymes [BR:sun01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     SUN_0487
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     SUN_0487
Mitochondrial biogenesis [BR:sun03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    SUN_0487
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-ProteinID: BAF71447
UniProt: A6Q7I8
Position
complement(494901..495191)
Genome map
AA seq 96 aa AA seqDB search
MQIDNTVLEKLEKLSHLRIDDSKKEEVMGQLSEILGYIDNLNELNTDHLDAAFSTLKGGT
PLREDIPRTENNIARDILSRAPESKDDFFIVPAIIE
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
gtgcagatagacaacactgttttggaaaaactcgaaaaactctcccatcttcgtatcgat
gattcaaaaaaagaggaagtgatgggtcagctgagtgaaatactcggctacatcgataat
ctcaacgaactcaatacggatcatctcgatgcagccttttcgacactgaagggaggaaca
cccttgagagaggacatcccaagaacagagaataacattgccagggacattctctcccgt
gcacctgaaagcaaagatgactttttcattgtacctgcgattatcgaataa

DBGET integrated database retrieval system