KEGG   Sulfurovum sp. NBC37-1: SUN_0543Help
Entry
SUN_0543          CDS       T00572                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
sun  Sulfurovum sp. NBC37-1
Pathway
sun00730  Thiamine metabolism
sun00790  Folate biosynthesis
sun01100  Metabolic pathways
sun02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sun00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    SUN_0543
   00790 Folate biosynthesis
    SUN_0543
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SUN_0543
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sun04147]
    SUN_0543
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:sun00537]
    SUN_0543
Enzymes [BR:sun01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     SUN_0543
Exosome [BR:sun04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SUN_0543
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:sun00537]
 Enzymes
  SUN_0543
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase Sigma70_r1_1 TarH
Motif
Other DBs
NCBI-ProteinID: BAF71503
UniProt: A6Q7P4
Position
complement(554853..556175)
Genome map
AA seq 440 aa AA seqDB search
MKKISLLLITISFLTAAPKTSVIFMIGDGMGPAYTSAYRYYKDDPKTPKVEPTVFDEMLV
GMNTTYSENSLITDSAAAATALATGYKTKNGFIGATEKPHSQVKTLLEYAKEQGYITAMA
VTSTLTHATPAGFISKEHHRDKEADIAKDFFPATAKEKLKFDFLMGGGEIHFNEAYGDIN
QTAKKHNVALYRNGYDFDSIHNYPFIAFTAYDYAKFAIDEKDENRDRVSKMTQKALSLVE
NKPFFMMIEGSQIDWCGHINDIACAMAEMDDFAKAVEKVKNYVDTHPDTLLIVTADHSTG
GLAIGDKIGKSDKVSDEIRSRSYIWYKDVIKKVKASSITIAEALRTTKNIDKSFENYTGI
DLTDKEYDQLASAMKKKDKKLCNAVNEIINQRSNTGWTTHGHTLVDVETFAYGKSSEKFR
GLLDNTDIAKKLFKVLSAGK
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatatcactcttactcatcacaatctcttttttgaccgctgcgccaaaaaca
tccgttatttttatgatcggggacggtatgggaccggcctatacctcagcatatcgctac
tacaaagatgatccgaagacgccaaaagtcgagcctacggtctttgacgagatgctggtc
ggtatgaataccacctattccgaaaattcgcttatcaccgattcggcagcagcagctaca
gcactggcaacaggctacaaaactaagaacggttttatcggagcgactgaaaagccacac
tcacaggtaaaaacacttttagagtatgccaaagaacagggatatatcactgcaatggca
gtgaccagcaccctgacccatgccacccctgcaggattcatttctaaagaacaccacagg
gacaaggaagcggatatcgccaaggatttttttccggcaacagcgaaagagaagctgaaa
tttgattttctcatgggaggtggggagatccattttaatgaagcctatggtgacatcaac
cagacagcaaaaaaacacaatgtagcactttaccgtaacggttatgactttgatagcata
cataactatccgtttattgcatttactgcctatgattatgcaaaatttgccattgacgaa
aaagatgagaacagagaccgtgtatcaaaaatgacgcaaaaagccctttcgcttgtcgag
aacaagccattcttcatgatgatagaaggatcacagatagactggtgcggacatatcaat
gacattgcctgtgcaatggctgagatggatgattttgcaaaagcagtggaaaaagtcaaa
aactatgtagacacccaccctgatacattgctcatcgttacggcagatcattccaccggc
ggcctggcaataggagacaagatagggaaatcggacaaggtttcagacgaaatacgcagc
aggtcatacatctggtataaagatgtgataaaaaaggtcaaagcctcttccattaccata
gccgaagcgttacgcacaacaaaaaatatcgacaaaagcttcgaaaactataccgggatt
gatctgacagataaagaatatgaccaacttgcctctgccatgaaaaagaaggacaagaaa
ctctgcaatgctgtcaatgagatcatcaatcagcgatccaatacaggatggacaacacat
ggacatacccttgtagatgtagagacttttgcctatgggaaaagcagtgaaaagttcaga
ggtttgctagacaatacagatattgcaaaaaaattatttaaagtgttatcagcaggaaaa
taa

DBGET integrated database retrieval system