KEGG   Sulfurovum sp. NBC37-1: SUN_0967Help
Entry
SUN_0967          CDS       T00572                                 

Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sun  Sulfurovum sp. NBC37-1
Pathway
sun00010  Glycolysis / Gluconeogenesis
sun00620  Pyruvate metabolism
sun00640  Propanoate metabolism
sun00680  Methane metabolism
sun01100  Metabolic pathways
sun01110  Biosynthesis of secondary metabolites
sun01120  Microbial metabolism in diverse environments
sun01130  Biosynthesis of antibiotics
sun01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sun00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SUN_0967
   00620 Pyruvate metabolism
    SUN_0967
   00640 Propanoate metabolism
    SUN_0967
  Energy metabolism
   00680 Methane metabolism
    SUN_0967
Enzymes [BR:sun01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SUN_0967
Lipid biosynthesis proteins [BR:sun01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SUN_0967
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: BAF71924
UniProt: A6Q8W5
Position
986185..987936
Genome map
AA seq 583 aa AA seqDB search
MEERRIKKNPADFLVQPNMTDYEVTYDSFDWESIAKEFEGLPGGGLNIAHEAIDKHANGA
LAEKAALIWLGENSEKRTYTFAQMKRESAKFANVLKSLGFEKGERVYTLSTRLPELYIGT
MGILKNGSVMCPLFSQFGPEPILQRMQRGDARGLLTTQRLYEKKIAPQMDQLPELRTILL
IDAEEDVNEKVLSLPRLMEKASDSFEIVHTEPEDMSLLHFTSGTTGMPKGVIHVHKAMYT
HWVTGAYVLDLHPDDMYWCTADPGWVTGTSYGIIAPWLHGVTNVVDEAEFDAERWYGILQ
EHKISVWYTAPTAIRRLMRLDIEPLESYDLSHLRLVQSVGEPLNPEAVIWGVEKLKMPIH
DNWWQTETGGIMIANYLCQDVKPGSMGRPLPGIVAAVVRQNGDGTVTEIREPGKDGDLAL
KPGWPSMFRGYLHNEEKYKKSFVDGWYISGDLAYRDEDGYFWFVGRADDIIKTSGHMVGP
FEVESALMEHPAVAEVGVIGKPDPLIGQMVKAFVSLKSGYEPTEKLKRELIGFGRKKLGA
AVAPKEIEFQENLPKTRSGKIMRRLLKARELGLPEGDTSTLEK
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atggaagagagacgtatcaaaaaaaatcctgctgattttttagttcagcccaatatgaca
gactatgaggtgacctacgacagttttgactgggagagtatcgccaaagagttcgaaggc
ttgcctggaggcggcctgaacatcgcccatgaagcgatagacaagcatgccaacggtgcg
ctggccgagaaagcggccctgatatggctgggagagaacagcgagaagcgtacctatact
tttgcgcagatgaaacgggagagtgcaaagttcgccaatgtactcaaatcactcggtttt
gaaaaaggagaacgtgtctatacactttcgacgcgtcttcccgaactctatattggaacg
atggggatactcaaaaacggttcggtgatgtgcccgctcttctcccagttcggtcctgaa
ccgatactgcagcggatgcagcgcggcgatgcccgcgggcttctgacgacacagaggctg
tatgagaaaaagatcgctccccagatggaccagcttcccgaactgcgtaccatcctgttg
atcgatgccgaagaggacgtgaacgagaaggtgctttccctgccgcgtctgatggaaaaa
gcgtcggacagtttcgagatcgtgcatacggagccggaagatatgtcactgctgcatttt
accagcggaacgacgggtatgcccaaaggggtgatacatgtccataaggcgatgtacacg
cactgggtgacgggtgcctacgtactggaccttcatcctgacgatatgtactggtgtacc
gccgatccgggttgggtgacgggtacctcctacggcatcatcgcgccctggctgcacggg
gtgaccaatgtcgtggatgaagcggagttcgatgccgaacgctggtacggtattttgcag
gagcacaagatctctgtctggtacaccgcacccacggcgatccgccgtcttatgcgtctc
gatatcgaacctcttgaaagctatgatctttcacatttgcgtctggtacagagtgtcggc
gaacccctcaaccccgaagcggtcatttggggtgtagagaaacttaaaatgccgatccat
gacaactggtggcagacggagacgggcggtatcatgatcgccaactatctctgccaggat
gtcaaaccggggtccatgggacggccgctgccgggtatcgttgccgcggtggtgcgtcag
aacggtgacggaacggtcacggagatcagggaacccggaaaagacggcgacctggcattg
aaaccgggatggccttcgatgttccgcggctatctgcacaatgaagaaaaatataaaaaa
agctttgtggacggctggtatatttcgggtgaccttgcctacagagatgaagacggttac
ttctggttcgttggacgcgcggatgatatcatcaagacttcagggcacatggtcgggccg
ttcgaggtggaaagtgcgctgatggagcatccggcagtggcggaagtcggcgttatcggt
aagcccgatccgctgatagggcagatggtcaaagcctttgtttccctgaaaagcggttat
gaacccaccgaaaagctcaaacgtgaactgatagggttcggacgcaaaaaactgggtgcc
gcggtggcgccaaaagagatagagttccaggagaacctgcccaagacccgaagtgggaag
atcatgcgccgtctgttgaaggccagagagcttggattgccagagggtgatacctcgaca
ctggaaaaataa

DBGET integrated database retrieval system