KEGG   Sulfurovum sp. NBC37-1: SUN_1290Help
Entry
SUN_1290          CDS       T00572                                 

Gene name
gpmA
Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sun  Sulfurovum sp. NBC37-1
Pathway
sun00010  Glycolysis / Gluconeogenesis
sun00260  Glycine, serine and threonine metabolism
sun00680  Methane metabolism
sun01100  Metabolic pathways
sun01110  Biosynthesis of secondary metabolites
sun01120  Microbial metabolism in diverse environments
sun01130  Biosynthesis of antibiotics
sun01200  Carbon metabolism
sun01230  Biosynthesis of amino acids
Module
sun_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sun_M00002  Glycolysis, core module involving three-carbon compounds
sun_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sun00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SUN_1290 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    SUN_1290 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SUN_1290 (gpmA)
Enzymes [BR:sun01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SUN_1290 (gpmA)
Membrane trafficking [BR:sun04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SUN_1290 (gpmA)
Exosome [BR:sun04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SUN_1290 (gpmA)
  Exosomal proteins of melanoma cells
   SUN_1290 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: BAF72243
UniProt: A6Q9T4
Position
complement(1324090..1324782)
Genome map
AA seq 230 aa AA seqDB search
MASTLILLRHGQSVYNQKNIFTGWTDIELSDQGRQEAKKAATELKRLKLYPDVCYTSWLK
RAIHTAQIALSQMAWEHIDCIKSWKLNERHYGAWQQCNKDVVKQEIGEEAFLSVRRGYST
PPPPLDENDPRAAKFDPKYRDLDPAQLPKSESLKDTHARVKEYYRDVLIPELSKGKTVLV
SAHGNSLRALVMEIEGLSTDAVVKLEIPTGKPLVYRYDTGMTAIKKVKVD
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaacactgatacttttacgacacgggcagagtgtctataaccaaaagaacatc
ttcacggggtggacagatatcgaactgagtgatcagggacggcaggaggcgaaaaaagcg
gctacggaactgaaaagactgaagctctatcctgatgtctgttatacctcctggcttaaa
cgcgcgatccatacggcacagatcgcattgtcccagatggcgtgggaacatatagattgc
atcaagagctggaagctcaatgaacgccactacggcgcctggcaacagtgcaacaaagat
gttgtaaaacaggaaataggcgaggaagccttcttaagcgtcaggagaggctacagtact
ccgccgcccccactggatgagaacgatccccgcgccgcgaagttcgaccccaaatacaga
gatctcgacccggcacagctgcccaaaagcgaatcactgaaagacacccacgcgagagtg
aaagagtactatcgtgacgtgctcattcccgagttgtcgaagggaaagacagtccttgtc
agcgcacacggaaattcactgcgtgccctggtcatggaaatcgaaggcttaagtaccgat
gccgtcgttaaactcgagatcccgacagggaaaccgctggtctaccgttatgacacaggg
atgactgccatcaaaaaagtgaaagttgattga

DBGET integrated database retrieval system