KEGG   Sulfurovum sp. NBC37-1: SUN_1695Help
Entry
SUN_1695          CDS       T00572                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
sun  Sulfurovum sp. NBC37-1
Pathway
sun00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sun01100  Metabolic pathways
sun01110  Biosynthesis of secondary metabolites
sun01130  Biosynthesis of antibiotics
sun01230  Biosynthesis of amino acids
Module
sun_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sun00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SUN_1695
Enzymes [BR:sun01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SUN_1695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C NanE
Motif
Other DBs
NCBI-ProteinID: BAF72645
UniProt: A6QAY6
Position
complement(1750667..1751461)
Genome map
AA seq 264 aa AA seqDB search
MAQILDEIIKKTREDLEKRKVDYPVEWLGRSLAFNPFVPKDVQSALRATEENPYRIIAEV
KKASPSKGIIREDFDPVVIAQAYEKGGADSLSILTEPHFFKGDKEYLGMVRRYVSIPLLR
KDFIVDKYQIVEALAFGADYILLIAKALSRKELKELYDYALHLGLDVLVEVHDKTDLVKA
MFAGANIIGINHRNLETFEMDMKLSEKLIPLIPNGKIIVAESGINDHETVVELSKIGADA
FLVGEHFMRQDDITAAIKAVKYGE
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggcacagattttagatgagatcatcaaaaaaaccagagaagatctggaaaaaagaaaa
gtggactaccccgtagagtggttgggacgttcactggcattcaatccttttgtacccaaa
gatgtacagtcggcacttcgtgctacggaagagaacccctaccgtattattgcagaggtg
aaaaaggcaagtccgagcaaaggcatcatccgtgaagacttcgaccctgtggtcattgcc
caggcgtatgaaaagggcggtgctgattcactttccattttgaccgaaccgcattttttc
aagggtgacaaagagtacctggggatggtgcgtcgttatgtcagtattccgctgctcaga
aaagatttcattgttgacaaataccagatcgtcgaagcgttggcattcggggcggattac
atccttttgatcgccaaagcactttcaagaaaagagctcaaagagctctatgactatgca
ctgcaccttggactggatgtactggtcgaagtacatgacaaaacagacctggtcaaagcg
atgttcgccggtgcgaatatcatcggtatcaatcacaggaacctggaaacattcgagatg
gatatgaaactgagcgaaaagctgatccctctcattcccaacggaaagatcattgtcgcc
gaaagcggtatcaacgaccatgaaacagtggtcgaactttccaaaataggggcggatgca
ttccttgtgggtgaacacttcatgagacaggatgatattaccgcggcgatcaaagcggtg
aaatacggagaatga

DBGET integrated database retrieval system