KEGG   Sulfurovum sp. NBC37-1: SUN_1813Help
Entry
SUN_1813          CDS       T00572                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sun  Sulfurovum sp. NBC37-1
Pathway
sun00260  Glycine, serine and threonine metabolism
sun00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sun01100  Metabolic pathways
sun01110  Biosynthesis of secondary metabolites
sun01130  Biosynthesis of antibiotics
sun01230  Biosynthesis of amino acids
Module
sun_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sun00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SUN_1813
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SUN_1813
Enzymes [BR:sun01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SUN_1813
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: BAF72760
UniProt: A6QBA1
Position
1862554..1863777
Genome map
AA seq 407 aa AA seqDB search
MATNIFNCPLPDEKGYFGEYGGAFIPPELQTIMDEITASYEEIRQDPAFLEELADLYQHY
VGRPSPIFHAKHLSEKYGADIYLKREDLNHTGAHKINHCLGEALLAKKMGKKKIIAETGA
GQHGVALATAAALVGLECDIYMGEVDMAKEHPNVVRMHILGANVIPATHGRRTLKEAVDT
AFENYLKDPVTQLYAIGSVVGPHPFPRMVRDFQSIVGVEAREQFQQMTGKLPDNLVACVG
GGSNAMGLFTAFIDDETVAMHGVEPAGRSLDIPGENAATITLGKPGVMHGFKSYMLQDEN
GEPQEVYSVASGLDYPSVGPQHAYLKDIGRVNYSSINDKEAIDAFFELSREEGIIPAIES
AHAVAYALKLAKEPDVGSILVNLSGRGDKDIDFVVENYGKDYGIPQD
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaaatattttcaactgtccgctaccggatgaaaaagggtatttcggagagtat
ggcggcgcattcatcccgcctgaactacagacgatcatggatgagattacagcttcttat
gaagagatcagacaggatcctgcattccttgaggagcttgcagacctttaccagcattac
gttggccgtccaagcccgatcttccatgcgaagcatctttccgaaaagtacggtgcagac
atctaccttaaaagggaagacctcaaccataccggcgcacataagataaaccactgtctg
ggcgaagcactgcttgccaagaaaatgggcaaaaagaagatcatcgctgagaccggtgcc
ggacagcacggtgtggcacttgctacggcagcggcccttgtgggactggaatgtgacatt
tatatgggtgaggtcgatatggcaaaagaacatccaaatgtggttagaatgcacattctc
ggtgccaacgtcatccctgctacacatggcagacgtaccctcaaagaggccgtcgatacg
gcattcgagaattaccttaaagatccggtgacacaactttacgccatcggctccgtcgta
ggtccccaccctttcccgcggatggtaagagatttccaatccatcgtaggggtagaagcc
agagagcaattccagcaaatgacaggaaagcttccggacaatcttgtcgcctgtgtaggt
ggcggttcaaatgctatgggactttttactgcattcatcgatgacgaaaccgttgccatg
cacggtgtagaacctgccggcagaagcctcgatatccctggagagaatgccgcgaccatc
actttgggcaaaccgggcgtcatgcacggctttaaatcctacatgcttcaggatgaaaac
ggtgaaccacaggaggtttactcggttgccagcggacttgactacccttccgtagggccg
cagcatgcctatctcaaggatatcggacgtgtcaactacagttccatcaacgacaaagag
gcgatcgatgcattcttcgaactctcacgagaagaggggatcatccctgccatcgagtcg
gcacacgcagtcgcctatgcgctcaaacttgccaaagagcctgacgtggggagcattctg
gtgaacctctcaggacgcggggacaaagatatagactttgttgtggaaaattacggtaag
gattacggtattccccaggattga

DBGET integrated database retrieval system