KEGG   Sulfurovum sp. NBC37-1: SUN_2098Help
Entry
SUN_2098          CDS       T00572                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sun  Sulfurovum sp. NBC37-1
Pathway
sun00260  Glycine, serine and threonine metabolism
sun00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sun01100  Metabolic pathways
sun01110  Biosynthesis of secondary metabolites
sun01130  Biosynthesis of antibiotics
sun01230  Biosynthesis of amino acids
Module
sun_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sun00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SUN_2098 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SUN_2098 (trpA)
Enzymes [BR:sun01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SUN_2098 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA PcrB His_biosynth
Motif
Other DBs
NCBI-ProteinID: BAF73039
UniProt: A6QC30
Position
2179326..2180069
Genome map
AA seq 247 aa AA seqDB search
MDKKLVAYITTGFPSLNFTIDAALALAEAGVDTLELGMPFSDPVADGPVIEAANLKALQN
GFKLEHLFEASAKIAPHIDTLWMGYFNPFYHRGMDYFISQAKETGVNGFIIPDLPFEEAK
PYKPAIEAAGLSLIDFIAPTDTKERIEEIVTDAKKFIYLVAYAGITGTGQSEDLQPIISD
IKEFTQTPIYVGFGVDQNTAREKAKGVDGVIVGSAFVKVLLDENLNNTQKIAKISEIAKE
IKERINS
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
ttggataaaaaattagttgcctatattaccaccggtttcccttcattgaacttcacgata
gatgctgcactggcattggcggaagccggtgtggatacactcgaactcggtatgcccttc
tccgatccggtcgctgacggtcctgtcatagaagctgccaacctcaaagcacttcaaaac
ggcttcaaactggagcatctattcgaggcttctgctaaaatagcgccacatatcgataca
ctctggatgggctatttcaatcccttctaccacagaggaatggactatttcatttcccag
gcaaaagagacgggtgtgaacggattcatcatccccgatctcccttttgaagaggctaaa
ccttacaagcctgccattgaagctgccggactgagtctgatagacttcatcgcacctaca
gataccaaagagcgtatcgaagagatcgtgaccgatgccaagaagttcatctatcttgtt
gcctatgcagggatcaccggtacgggacagagtgaagaccttcagcctattatttctgat
atcaaagaattcacacaaactcccatctatgtgggtttcggtgtcgatcagaatacggcc
agagaaaaagccaaaggggtcgatggtgtcattgtaggttccgctttcgtgaaagtactg
cttgacgagaatttaaataacactcagaagatcgcaaaaatttcagagatcgcaaaagag
atcaaagagaggatcaacagctaa

DBGET integrated database retrieval system