KEGG   Sulfurovum sp. NBC37-1: SUN_2274Help
Entry
SUN_2274          CDS       T00572                                 

Definition
(GenBank) inorganic phosphate transporter, PiT family
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
sun  Sulfurovum sp. NBC37-1
Brite
KEGG Orthology (KO) [BR:sun00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    SUN_2274
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 DUF4396 MapZ_EC1 Helicase_IV_N
Motif
Other DBs
NCBI-ProteinID: BAF73214
UniProt: A6QCK5
Position
complement(2378912..2380456)
Genome map
AA seq 514 aa AA seqDB search
MNNTIKLLLGAAFAAVVAFYASSIMGHGAHAGFMVLAAVFGAYMAMNIGANDVANNVGPA
FGSGAITMGGVIVIAAIFEATGALVAGGDVVGTIKKGIIDPAAFGNDPMLFVYAMSAALL
AAALWLNLATWLKAPVSTTHSIVGGVVGAGIAAGGFAIVSWGTMGKIAASWVISPVLGGV
IAAIFLYVIKSQILYQKDMRSAAKKVVPILVAIMAAAFLTYLTLKGLKHVWKDLTHVISF
LPQTKKPTFGIAVIIGLIGGFITYVMVKPRILKKVENGLGENRADINILFGIPLVFSAIF
LSFAHGANDVANAVGPLAAVYDALTHAAIATKAAIPLWVMVVGGVGISIGLALYGPRLIR
TVGSEITELDEMRAFSIMMAAAITVIIASQLGLPVSSTHIAVGAVFGVGFLREWLDSKNM
DEKQQKLQVEVEKLDQIKAELNALKSEEDYKKQVELIDAQKRQKKKVKSIKRSLRENYVK
RGMVKKIIAAWIITVPAAAFLSAIIFFMIKGFAA
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatacgatcaaacttctgcttggggcggcttttgccgcagtagtggctttttat
gccagcagtatcatggggcatggtgcccatgcaggatttatggtacttgcagcggtattt
ggtgcctatatggcaatgaatatcggtgcaaatgatgtagcgaacaatgttgggccggct
ttcggttcgggtgcgatcaccatgggcggcgttatcgtcatcgctgccatctttgaagcg
actggtgcgttggttgccggcggtgatgttgtgggtacgatcaaaaagggtatcatcgat
cctgcggcattcggaaacgatccgatgctgttcgtgtatgccatgtctgcagcactgctt
gctgcagcactctggttgaacctggcaacctggctcaaggcaccggtctctacgacacac
tccattgtcggtggtgtcgttggtgcagggatcgcagcgggcggatttgccatcgtttca
tggggaaccatgggcaagattgcggcatcatgggttatctctccggtacttggcggtgtg
atcgcggcgatcttcctctatgtcatcaaatcgcagatcctctaccagaaagatatgcgc
agtgcagccaaaaaagtggtgccgatccttgtagcgatcatggccgcggcttttttgacc
tatctaacacttaaaggattgaaacatgtatggaaagaccttacgcatgtgataagcttc
ctgcctcaaaccaaaaaacctacgtttggtattgctgtgattattggattgatcggcggc
tttattacgtatgtaatggttaaacccagaatactcaaaaaagtggagaacggacttggt
gagaatagagccgatatcaacattttgttcggtataccgcttgtcttctccgcgatcttc
ctcagttttgcacacggtgcaaacgacgtcgccaatgccgttggaccattggcagcggtg
tacgatgcattgacacatgcagcgatagcaacaaaagcagccattccgttgtgggttatg
gttgtaggtggtgtgggtatctctatcggtctggcactttacggtccaagactgataaga
acggttggttctgagatcaccgaacttgatgagatgagggccttctccattatgatggct
gcagcgatcaccgttatcatcgcatcacaactgggactgcctgtttcctctacgcatatt
gcagtaggtgcggtatttggtgtaggcttccttcgtgaatggcttgacagcaagaacatg
gatgagaagcagcaaaaactgcaggtcgaagtcgaaaaactcgatcagatcaaagcggaa
ctcaatgccctgaaaagcgaagaagactataaaaagcaggttgagctgatcgatgctcag
aaaagacagaagaaaaaagtgaaaagtatcaagcgttcactccgtgagaactacgttaag
cgcggcatggtgaaaaagatcatcgcggcatggatcatcaccgttcctgcggcagccttc
ctttcagcgattattttcttcatgatcaaaggttttgctgcctaa

DBGET integrated database retrieval system