KEGG   Streptococcus suis SS12 (serotype 1/2): SSU12_0180Help
Entry
SSU12_0180        CDS       T02025                                 

Definition
(GenBank) Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
suo  Streptococcus suis SS12 (serotype 1/2)
Pathway
suo00010  Glycolysis / Gluconeogenesis
suo00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:suo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSU12_0180
   00500 Starch and sucrose metabolism
    SSU12_0180
Enzymes [BR:suo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SSU12_0180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-ProteinID: AER14377
Position
171318..172718
Genome map
AA seq 466 aa AA seqDB search
MVTEQREYRFPEGFLWGSSTSGPQSEGSVAGDGKGWNNWDYWYSQEPELFHQQIGPEQTS
TFYEHFQSDLDLLVETCHSIFRTSIQWSRLIPEGIGEVNPQAVEFYRAVFAGIRERGIKL
LVNLYHFDLPYVLQEKGGWENKEIVWAYEAYARQCFSLFGDLVDHWITFNEPIVPVECGY
LGSYHYPCKVDAKAAVVVAYHTQLASSLAVRACHQLHPDHKISIVLNLTPAYPRSQSPED
LQAARIAELFQTRSFLDPSVLGQYPRELVDILEKHGLRPETTEEELTIIKENRVDFLGVN
YYQPLRVQAPSEDGWNGEPTFLSQYFQPYDKPDKKINPHRGWEIYEEGLYDIAKNIQENY
GNIEWLVTENGMGVEGEGVFEENGMIQDDYRIHFMEDHLIQLHRGIDEGANCKGYMVWTF
IDCWSWLNTYKNRYGLVSLDLQTQKRTVKKSGYWFKQVSAKNGFIR
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggtaactgagcaaagagagtatcgttttccagaaggttttttgtggggatcctccact
tcagggcctcaaagtgaaggaagtgtagctggtgatggaaaggggtggaataactgggat
tactggtacagtcaggaacctgagctctttcaccagcaaataggaccggaacaaacatcg
actttctatgaacatttccagtcagatttggatttgttggtggaaacatgtcatagtatt
tttcgcacctctatacagtggtcacgtctgattccggaagggataggcgaggtcaatccg
caagctgtggagttttatagggctgtatttgcaggtattcgagagcgtgggataaagctt
ttggtcaatctttatcatttcgatttgccttatgtcttacaggaaaaagggggctgggaa
aataaggagattgtctgggcctatgaggcttatgctcgccagtgtttcagcctctttggg
gatttggtggatcattggattacctttaatgaacccattgttccagtagaatgtggctat
ctaggaagctatcattatccttgcaaggtggatgcaaaggcagctgtggtcgtagcgtat
catacgcaattagccagttctttggcagttcgggcctgtcaccaactacacccagaccac
aaaatttccattgttctcaatcttactcctgcctatccaagaagtcagagtccagaagat
ttacaggcagcacggattgctgagctatttcaaacgagaagctttttggatccatccgtt
ttgggacaatacccgagggagctggttgacattcttgaaaaacacggtttacgtccagaa
accacagaggaggaattgaccattatcaaagaaaatagggttgacttcctgggggtgaat
tattaccagcccctgcgcgtgcaggctccttcagaagatggatggaacggagagcctact
ttcctatcccaatatttccagccttatgataagcctgacaagaaaatcaatccccataga
ggctgggaaatttacgaagaagggctgtacgatattgctaaaaatatccaggaaaactat
ggaaatatcgaatggttggtaactgagaacggcatgggagtcgaaggggagggtgttttt
gaagaaaatggcatgattcaggatgactatcggattcacttcatggaagaccatttgatt
cagctccatcgaggtattgatgaaggggcgaactgtaagggctatatggtctggaccttt
attgactgctggtcttggttaaatacctataagaaccgatacggtttggtctcgcttgac
cttcaaactcagaagcgtactgtcaaaaaatctggatattggttcaagcaagtgagtgct
aaaaatggttttattagatag

DBGET integrated database retrieval system