KEGG   Streptococcus suis SS12 (serotype 1/2): SSU12_0502Help
Entry
SSU12_0502        CDS       T02025                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
suo  Streptococcus suis SS12 (serotype 1/2)
Pathway
suo00010  Glycolysis / Gluconeogenesis
suo00030  Pentose phosphate pathway
suo00051  Fructose and mannose metabolism
suo00052  Galactose metabolism
suo00680  Methane metabolism
suo01100  Metabolic pathways
suo01110  Biosynthesis of secondary metabolites
suo01120  Microbial metabolism in diverse environments
suo01130  Biosynthesis of antibiotics
suo01200  Carbon metabolism
suo01230  Biosynthesis of amino acids
suo03018  RNA degradation
Module
suo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:suo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSU12_0502
   00030 Pentose phosphate pathway
    SSU12_0502
   00051 Fructose and mannose metabolism
    SSU12_0502
   00052 Galactose metabolism
    SSU12_0502
  Energy metabolism
   00680 Methane metabolism
    SSU12_0502
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SSU12_0502
Enzymes [BR:suo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SSU12_0502
Protein phosphatases and associated proteins [BR:suo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SSU12_0502
Messenger RNA biogenesis [BR:suo03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     SSU12_0502
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase Peripla_BP_1 DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AER14693
Position
528553..529563
Genome map
AA seq 336 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAVVRQAISEGMEVYGINEGYAGMVAGDIHELSARSVGDI
ISRGGTFLCSARYPEFAKLEGQLKGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAI
GVPGTIDNDIVGTDFTIGFDTAVTTAMDAIDKIRDTSSSHRRTFVVEVMGRHAGDIALWA
GIASGADVIVVPEEDFNINDVVDRIKAGYDKGKKHSIIVLAEGVMPAAQFAEELKAAGDT
SDLRVTELGHIQRGGSPTARDRVLASRMGAHAVKLLKEGRGGLAVGIRNEQMVENPILGT
AEEGALFSLTTDGKIVVNNPHKADLELADLNRNLSI
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttgaccagtggtggtgatgcccctggtatgaacgctgctatt
cgtgcagttgttcgccaagcaatttcagaaggaatggaagtttatggaatcaacgaaggt
tacgcaggtatggttgcgggtgatatccatgaattgtctgcacgttctgtaggtgatatt
atttcacgtggaggaacattcctttgttcagctcgttatccagaatttgccaaattagaa
gggcaacttaaagggattgagcaattgaaaaaacatggtatcgaaggtgtagttgttatc
ggtggtgatggttcttaccacggtgcaatgcgcttgacggagcatggtttcccagctatt
ggtgtacctggtacaattgataacgacatcgtgggtacagattttacaatcggttttgat
acagctgtaacaactgctatggatgcgattgataaaatccgcgatacttcatcaagtcac
cgtcgtactttcgttgttgaagtaatgggacgtcatgcgggagacatcgctctttgggct
ggtattgcttctggtgcagatgttatcgttgttccagaagaagacttcaatatcaacgat
gttgttgatcgcattaaagcgggctacgataaaggtaagaaacatagcatcattgtcttg
gccgaaggtgttatgccagcggcacagtttgctgaagaattgaaagcagcaggcgataca
agtgatcttcgtgtgacagaacttggtcatatccaacgtggtggttctccaacagcgcgt
gatcgtgtactcgcttctcgtatgggtgctcatgccgttaaattgcttaaagaaggccgt
ggaggtcttgcggtaggtatccgtaacgagcaaatggttgaaaatccaattcttggaact
gcagaagaaggtgccttgtttagcttgactactgatggcaagattgtagttaataatccg
cataaagcagatttggagttggctgatttgaaccgtaacttgtcaatctag

DBGET integrated database retrieval system