KEGG   Streptococcus suis SS12 (serotype 1/2): SSU12_0720Help
Entry
SSU12_0720        CDS       T02025                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
suo  Streptococcus suis SS12 (serotype 1/2)
Pathway
suo00260  Glycine, serine and threonine metabolism
suo01100  Metabolic pathways
suo01110  Biosynthesis of secondary metabolites
suo01120  Microbial metabolism in diverse environments
suo01130  Biosynthesis of antibiotics
suo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:suo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SSU12_0720
Enzymes [BR:suo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     SSU12_0720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AER14907
Position
756566..757594
Genome map
AA seq 342 aa AA seqDB search
MLHFENDYNKGAHPALLEALVASNQEGLSGYGTDKYTESAIEKIRLATDCPHAQVTFLAG
GTQTNQIVISSMLASYEGVIAADTGHIAVHEAGAIEFTGHKVLALPHTDGKLVASEVENY
ISDFYADANHAHMVHPGMVYISHPTEYGTLYSKSELEALSTVCRHHNIPLFLDGARLGYG
LAARDTDLDLKTIAELTDVFYIGGTKLGALMGEALVFTKNNQPKNFVSIVKHHSALLAKG
RVTGIQFDCLFTDDLYLELGRHAIAMAEQLTQILEEKGFQFYLKSPTNQQFVIVKNEELT
RLTEVGIAYGFWEKYDDSHSIIRFATSWSTSQADIDALRNRL
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgttacattttgaaaatgactataacaaaggtgcccatcccgccttgctagaagcctta
gttgcaagcaaccaagaaggtttatctggatatggcactgataaatatactgaatctgct
atcgaaaaaatcagacttgctacggactgtcctcatgcacaagttacgtttttagcaggt
ggcacgcagaccaatcaaattgtcatttcgtctatgttagcttcctatgaaggagtcatt
gcagcggatactggtcatattgcagttcatgaagcaggggcaattgaatttacaggccat
aaggtgttggccttaccgcatacggatggcaaacttgtcgcaagtgaagttgagaactat
atttccgatttctacgcagatgctaatcatgctcacatggttcatccaggaatggtttat
atttcccatccaacagagtatggtacactttatagcaagtcagagttagaagccttgtca
acagtttgtcgtcatcataacatcccgctttttttagatggagctcgtttgggttatggt
cttgctgcacgcgatacggatcttgatttgaagacaattgcagagctgacagatgttttc
tacattggtgggacaaaactcggtgccttgatgggggaagctttggtatttacaaagaac
aaccagcctaagaatttcgtatcgattgtcaaacaccatagtgccttgttggcgaaagga
agagtgacaggtatccagtttgattgcttatttactgatgacttgtatcttgaattgggg
cgtcatgctatagcaatggcagagcaactgacccagattttggaagagaaaggctttcaa
ttctatctcaaatccccgaccaatcagcaatttgttattgttaagaatgaagaattgact
agattgacagaagttggaattgcctatggcttctgggagaaatacgacgatagccacagt
atcatccgctttgcgaccagctggtcaactagtcaagcggatattgatgcgttaaggaat
agattataa

DBGET integrated database retrieval system