KEGG   Streptococcus suis SS12 (serotype 1/2): SSU12_1327Help
Entry
SSU12_1327        CDS       T02025                                 

Definition
(GenBank) HAD family sugar phosphatase
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
suo  Streptococcus suis SS12 (serotype 1/2)
Pathway
suo00627  Aminobenzoate degradation
suo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:suo00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SSU12_1327
Enzymes [BR:suo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     SSU12_1327
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_like Hydrolase_6 HAD_2 Hydrolase Hydrolase_3
Motif
Other DBs
NCBI-ProteinID: AER15506
Position
complement(1353883..1354656)
Genome map
AA seq 257 aa AA seqDB search
MTYTGYLIDLDGTIYEGKKRIPAGERFIHRLQECQIPYLFVTNNTTRRPEMVQAMLAENF
NIETPLETIYTASLATVDYMNDLGKEKTVYVIGEDGLKSAIFEAGYVEDTENPAYVVVGL
DTQLTYEKLTIATLAIQKGATFIGTNPDLNIPTERGHLPGAGSLIALLKAATRVEPTFIG
KPEAIIMDKALEILGTERSQTVMVGDNYLTDIRAGIDNGFPTLLVLTGFTKPEEVADLPL
APTHVLNSLDEWSFDEN
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgacatatacaggttatttgattgatttggatggtacgatttatgaagggaaaaagcgg
attcctgctggtgaacgttttattcatcgcttgcaagaatgtcagattccctatttattt
gtgaccaacaataccacccgccgtcctgagatggtgcaggctatgttggctgaaaacttt
aacattgagacaccgcttgaaacaatctatacagccagtctggcgacagtagattatatg
aatgacttgggcaaggaaaagacagtctatgtcattggagaagacgggctcaagtctgcc
atttttgaggcaggttatgtggaagacacggaaaatccagcctatgttgttgtcggtttg
gatactcagttgacctatgaaaaactgaccattgccaccttggctattcaaaagggagcg
acctttatcggtaccaatcctgatttgaacattccgactgaaagaggtcatttgccagga
gcaggctcacttattgcgcttttgaaagctgctacccgagtagagccgacctttatcggt
aagcctgaagccattatcatggacaaggctctggagattttaggcacagaacgcagccag
acagttatggtaggagataactacctgacagatattcgtgcagggattgacaatggattt
ccaactcttttagtcctgacaggatttaccaagccagaagaagtagcagacttacccctg
gctccaacccatgtcctcaacagcctagatgaatggagttttgatgagaactaa

DBGET integrated database retrieval system