KEGG   Streptococcus suis SS12 (serotype 1/2): SSU12_1485Help
Entry
SSU12_1485        CDS       T02025                                 

Definition
(GenBank) putative 5'-nucleotidase
  KO
K01081  5'-nucleotidase [EC:3.1.3.5]
Organism
suo  Streptococcus suis SS12 (serotype 1/2)
Pathway
suo00230  Purine metabolism
suo00240  Pyrimidine metabolism
suo00760  Nicotinate and nicotinamide metabolism
suo01100  Metabolic pathways
suo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:suo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SSU12_1485
   00240 Pyrimidine metabolism
    SSU12_1485
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    SSU12_1485
Enzymes [BR:suo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     SSU12_1485
CD molecules [BR:suo04090]
 Proteins
  SSU12_1485
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:suo00537]
 Enzymes
  SSU12_1485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 5_nucleotid_C Metallophos Gram_pos_anchor Metallophos_2 Ribosomal_S5_C DUF5580
Motif
Other DBs
NCBI-ProteinID: AER15664
Position
complement(1481181..1483205)
Genome map
AA seq 674 aa AA seqDB search
MKKNIRLKSSILALVAGFSVIATQAVLADELAVQIMGVNDFHGALDMTGTARLEGETVRN
AGTAALLDAYMDDSQAEFEETAAETETPAESIRVQAGDMVGASPSNSGLLQDEPTVKVFN
KMDVEYGTLGNHEFDEGLDEYNRIMTGEAPKKGQFNEIVDNYTREAAKQEIVIANVIDKE
TGEIPYGWKPYAIKTIPVNDKEAKIGFIGVVTTEIPNLVLKKNYEQYTFLNEAETIAKYA
RELAEKGVNAIVVLAHVPATSKDGVAAGEAADMIAKLNEIYPEHSVDLVFAGHNHVYTNG
TTGKTLIVQATSQGKAYADVRAVYDTDIADFKAVPTAKIIAVAPGQKTPSPEIQAIVDEA
NTIVKKVTEQKIATASQATDISREVNEFKESAVGNLVTSAQLAIAKKSGYDVDFAMTNDG
GIRADLKVQEDGTVTWGAAQAVQPFGNILQVVQMTGEQIYTALNQQYDEGEKYFLQMSGI
KYIYTKADNPTEENPYKVVKAFKEDGTEIVPTETYTLVINDFLFGGGDGFSIFKEAKLIG
AINPDTEVFVEYLTDLEKAGQTISATIPGRKAFVEKYVEEPKAEEKEDNAGTTTDVKTPE
KANDGGDSVTNQKATEQPAPSGSMAPISNKKTEKASGNQTLPNTGQEALGSLLISLGGLV
SLGMAVSVRRKEGE
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaatattcggttgaaaagcagtatactagctcttgtagctggttttagcgtt
attgcaacacaagctgttttagcagatgaattagctgtccaaattatgggagttaatgat
ttccatggtgcgcttgatatgacggggacagcgcgattggaaggggaaacagttcgtaat
gcaggaactgccgctttacttgatgcttacatggatgattcacaagcagaatttgaagaa
acagcagcagaaacagagacacctgcagagtctatccgtgttcaagctggggatatggtt
ggtgcaagtccatcgaattctggacttttgcaagatgaaccaactgtaaaagtctttaat
aaaatggatgttgaatacggaactttggggaaccatgagtttgatgagggacttgatgag
tataaccgtatcatgactggtgaagctccaaaaaaaggtcagtttaatgagattgtagat
aattatactcgtgaagctgctaaacaggagattgttattgctaacgttattgacaaagaa
acaggtgaaattccgtatggttggaagccctacgctattaagactattcccgtgaatgat
aaagaagctaagattggctttattggtgtagttacgacagaaattcctaatcttgttttg
aagaaaaactatgagcagtacacttttttgaatgaggcagagacgattgctaaatatgcg
cgtgaattagctgaaaaaggtgtaaatgcgatagttgtactggctcacgttccggctaca
agcaaggatggtgtggctgctggtgaagctgcagatatgattgctaagctaaatgaaatc
tatcctgaacactcagttgaccttgtatttgctggccataaccatgtctatacaaacggt
acaacgggcaaaaccttgattgttcaagctacctcacaaggtaaggcttacgcagatgtt
agggctgtttatgatacagatattgccgactttaaagctgttccgactgcgaaaattatt
gcagtagcaccagggcagaaaacaccaagtccggaaattcaggcaattgtagatgaggca
aataccattgttaaaaaagtaactgagcaaaaaattgctacagctagtcaagcgacagat
atttcacgcgaagtgaatgaatttaaagaaagtgctgtaggtaatctagtaacatcggct
caattagctatcgctaagaaatcgggttatgatgttgactttgcaatgacaaacgatggc
gggattcgggcagatttgaaggtccaagaagatggaacagttacttggggagcagcacaa
gctgttcaaccatttgggaatatcctacaagtcgttcaaatgacaggtgagcagatttat
acagccttaaatcaacaatatgatgaaggtgaaaaatatttccttcaaatgtctggaatt
aaatatatctacacgaaggctgacaatccaacggaagaaaatccttataaggttgttaaa
gccttcaaagaagatgggacggagattgttccgacagaaacctatacacttgtcatcaac
gacttcttatttggtggtggggatggcttctcgattttcaaagaagctaaactgattggt
gctatcaatccagatacagaagtatttgtggagtacttgactgatttagaaaaagcaggt
caaaccattagtgcaacaattccaggtagaaaagcatttgtagagaagtacgtagaagaa
ccaaaagcagaagaaaaagaagataatgctgggacaactactgatgtgaaaacacctgag
aaagcaaatgacggtggcgatagtgtaacaaatcagaaagcaaccgagcaaccggcacca
tctggaagtatggctcctatttcaaataagaaaactgaaaaagcatcaggaaatcaaaca
cttccaaataccggtcaagaagccctaggctcacttcttattagcttgggtggcttagtt
tcactcggaatggctgtctcagtgagacgtaaggaaggggagtag

DBGET integrated database retrieval system