KEGG   Streptococcus suis SS12 (serotype 1/2): SSU12_1588Help
Entry
SSU12_1588        CDS       T02025                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
suo  Streptococcus suis SS12 (serotype 1/2)
Pathway
suo00071  Fatty acid degradation
suo00072  Synthesis and degradation of ketone bodies
suo00280  Valine, leucine and isoleucine degradation
suo00362  Benzoate degradation
suo00380  Tryptophan metabolism
suo00620  Pyruvate metabolism
suo00630  Glyoxylate and dicarboxylate metabolism
suo00640  Propanoate metabolism
suo00650  Butanoate metabolism
suo00900  Terpenoid backbone biosynthesis
suo01100  Metabolic pathways
suo01110  Biosynthesis of secondary metabolites
suo01120  Microbial metabolism in diverse environments
suo01130  Biosynthesis of antibiotics
suo01200  Carbon metabolism
suo01212  Fatty acid metabolism
suo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:suo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SSU12_1588
   00630 Glyoxylate and dicarboxylate metabolism
    SSU12_1588
   00640 Propanoate metabolism
    SSU12_1588
   00650 Butanoate metabolism
    SSU12_1588
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SSU12_1588
   00072 Synthesis and degradation of ketone bodies
    SSU12_1588
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SSU12_1588
   00310 Lysine degradation
    SSU12_1588
   00380 Tryptophan metabolism
    SSU12_1588
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SSU12_1588
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SSU12_1588
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SSU12_1588
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:suo04147]
    SSU12_1588
Enzymes [BR:suo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SSU12_1588
Exosome [BR:suo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SSU12_1588
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt FKBP_N
Motif
Other DBs
NCBI-ProteinID: AER15767
Position
1566494..1567678
Genome map
AA seq 394 aa AA seqDB search
MKKVAIVSAYRSAIGSFGGSLKDIEIADLGAQVLETALASKNIPADSVDEVIFGNVLSAG
QGQNIARQIAIRAGIPQTASAYAVNKVCGSGLKSVLLAAQSIMLGDNDVVVAGGIEIMSQ
APYLSKTSRFGSKFGHITLEDSMLTDGLTDAFNDYHMGITAENVAEHYQVSRAEQDAFTY
SSQEKAAKAIAEGRFVDEIVPIRLKNRKGETIFATDEYPRLTPIEKLATLRPSFKKDGTV
TAANASGINDGCAVLILMSDEKASELNIQPLTYIEAYATSGLDPALMGLGPITASQKALQ
KLNKTVEDIDLFELNEAFAAQSIPVVKQLGIDPAKVNVNGGAIALGHPIGASGSRILVTL
IHELIKQEKELGLCSLCIGGGQGISLIVSNAQTS
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtagctatcgtgtctgcctatcgttctgccatcggcagtttcggaggtagt
ctgaaagatattgaaatcgctgatttaggggcgcaagtcctcgaaacagccttagctagt
aaaaacatccctgcagacagcgttgatgaagttatcttcggaaatgttctttcagcagga
caaggacaaaatattgcacgtcaaattgctattcgtgcaggcattcctcagacagcctct
gcctatgcagtcaataaagtctgtggttccggtctcaaatcagtcctcctggctgcccag
tcaatcatgctaggtgacaatgatgtagttgtggctggaggcattgaaattatgagccag
gcaccttatctatccaaaactagcaggtttggtagtaaatttggtcatattactctagaa
gattctatgctgacagacggtctaacagatgccttcaacgactatcacatgggcattact
gcagaaaatgttgctgaacactatcaagtcagtcgcgcagagcaagatgcttttacatac
agtagccaagagaaggctgcgaaagctattgctgagggaagatttgttgacgaaattgtt
cctattagattaaaaaatcggaaaggcgaaactatttttgccacagatgagtaccctcgt
ctgacgccaattgaaaaattggcaacacttcggccatcttttaaaaaggatggaaccgtc
accgcagccaatgcttctggcatcaacgacggctgtgctgtcttgatactcatgtctgat
gaaaaagccagtgagctaaatatccagccactcacctatattgaggcctatgcaacaagc
ggtttagatcccgcattgatggggcttggacctattactgctagccaaaaagcgctacaa
aaactgaataaaacagtcgaggatatcgatctattcgaactcaacgaggcatttgcagcc
caatcaattccagttgtcaaacaactcggcattgatcctgcaaaagtcaatgtcaatggt
ggtgctatcgcccttggacatccaatcggagctagtggtagtcgaatcctagtcactctg
attcacgaattaatcaagcaagaaaaagagcttggtctttgctcactttgtatcggaggc
ggtcaaggcatctccctaatcgtttccaatgcgcaaacaagttaa

DBGET integrated database retrieval system