KEGG   Streptococcus suis SS12 (serotype 1/2): SSU12_2051Help
Entry
SSU12_2051        CDS       T02025                                 

Definition
(GenBank) 4-alpha-glucanotransferase
  KO
K00705  4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
suo  Streptococcus suis SS12 (serotype 1/2)
Pathway
suo00500  Starch and sucrose metabolism
suo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:suo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SSU12_2051
Enzymes [BR:suo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     SSU12_2051
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_77
Motif
Other DBs
NCBI-ProteinID: AER16226
Position
complement(2035262..2036779)
Genome map
AA seq 505 aa AA seqDB search
MKVRQSGVLMHISSLPGKYGIGSMGQSAYEFVDFLVRTKQRYWQILPLGTTSYGDSPYQS
FSAFAGNTHFIDFDILIDKGWLAAEDLHGVDFGQNPTEVDYAAIFYARRPLLEKVVANMK
AQGLPEDYWMFLGENDFWIHTFAEYMAIKEHFDLKPWTEWEDQGARLRYHDTLEYYRHLL
ADRIDYHRITQYLFFSQWKALKAYANAKGVEFVGDMPIYIAADSADMWANPHFFKTDEEG
KPSVVAGCPPDAFSEIGQLWGNPIYDWEAMKHDGFTWWVARLRESFKIYDMVRIDHFIGF
ASFWEIPAGEETAVNGYRVEAPGFELFDTIKRELGDLNIIAEDLGSVTDKVIQLRDTTGF
PGMKVLQFAFDPEGDSIEMPHNHPNNVVAYTGTHDNDTILGWYENETTKESRAFLDKYSN
RREGETVSHALFRLLFGSPAFMAVATMQDLLGLDGSARMNLPNTLGGNWTWRMTADQLTP
EIEAELLDLTETYRRVNVHLVDEKS
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaagacagagtggtgtgctgatgcacatttcatcattacctgggaaatatgga
attggttccatgggccaatcggcttatgaatttgttgattttttggtaagaactaagcaa
cgctattggcaaatcttacctttgggaacaaccagttatggagattctccttaccagtca
ttttcagcttttgcagggaatactcattttattgattttgatatattgattgataaaggc
tggctggcagcagaggatttacacggtgttgactttgggcagaatcctacagaggtagat
tacgcagccattttttatgctcgacgtccattactggagaaggtagttgccaacatgaag
gcacaaggcttgccagaagattattggatgttcttaggggagaatgacttttggattcat
acctttgcggagtatatggctataaaagagcattttgatctcaaaccttggacagagtgg
gaagatcaaggggcgcgcttacgttaccacgataccttggaatattatcgtcacttgttg
gcagatcgaattgattatcaccgcattacacaatatttattcttttcacaatggaaggct
ttaaaggcttatgccaatgccaaaggtgttgagtttgttggggatatgccgatttatatc
gcggctgattctgccgatatgtgggctaatccacatttctttaaaacggatgaagaaggc
aagccgagtgtggttgcaggatgcccaccagatgccttttcggaaattggtcagctttgg
ggcaatccgatttatgattgggaagcgatgaagcatgacggatttacttggtgggttgct
cgtttacgtgaatcctttaagatatacgatatggtacgtatcgaccactttatcggcttt
gcctccttctgggaaattccagcgggtgaagaaacagctgtaaatggctatcgtgtcgaa
gcaccaggttttgagttatttgatacaatcaaacgtgaactcggagacttaaatatcata
gctgaggatttgggctctgtgacagacaaggtcatccaattacgtgatacgacaggtttt
cctggtatgaaagtcctgcagtttgcttttgatccagaaggagacagcattgaaatgcca
cataaccatcctaataatgtggtggcatatacgggaacccatgacaatgatacgattctt
ggctggtacgaaaatgaaacaacgaaagaatcgcgtgcattcttagataagtacagcaat
cgtcgtgagggggaaacggtcagtcatgctcttttccgtctgctctttggttcacctgcc
tttatggcggtggctactatgcaggacctacttggtttggatggttcagctcgcatgaac
ttgccaaatacgcttggtggtaactggacttggagaatgacggcagatcaattgacacca
gagattgaagcggaattgctagaccttacagaaacttatcgtcgggttaatgtgcatttg
gttgatgaaaagtcataa

DBGET integrated database retrieval system